(data stored in ACNUC7421 zone)

EMBL: AP009493.PE360

AP009493.PE360       Location/Qualifiers
FT   CDS_pept        391938..392615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_360"
FT                   /product="putative peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17189"
FT                   /db_xref="GOA:B1VQ88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ88"
FT                   /protein_id="BAG17189.1"
FT                   /translation="MAEPLIHYDGFSRRAAASRCAELLDLVGLPAARERLRSYPHELSG
FT                   GMRQRVLIAMAISREPQVLIADEPTTALDVTIQSQVLQLIDRLRKDLRMALILITHDLG
FT                   VVAGVTDRIAVMYAGRIVETAPTTAIFDHPGHPYTRALMESIPRMDRERVEHLPAIPGF
FT                   PPDPAAPPPGCAFQPRCSAARAACEDAVPVLLPLTSSAHGHLVRCPYPAPVPVGADHRG
FT                   EPS"
     atggccgaac ccctcatcca ctacgacggg ttcagccggc gggcggccgc ctcccggtgc        60
     gcggaactcc tggacctcgt gggcctgccc gccgcacgcg aacggctccg cagctacccc       120
     cacgagctct ccggcggcat gcgccaacgc gtcctgatcg ccatggccat cagccgcgaa       180
     ccccaggtcc tgatcgccga cgagcccacc accgccctcg acgtcaccat ccagtcccaa       240
     gtgctccagc tcatcgaccg gctccgcaaa gacctccgga tggccctcat cctcatcacc       300
     cacgacctcg gggtcgtcgc cggagtcacc gaccgcatcg cggtgatgta cgcgggccgg       360
     atcgtggaga cggcgcccac caccgcgatc ttcgaccacc ccggtcaccc ctacacccgc       420
     gccctgatgg agtccattcc ccggatggac cgcgaacggg tcgaacatct gccggccatc       480
     cccgggttcc cgcccgaccc cgccgcgccg ccgcccggct gcgccttcca gccccgctgt       540
     tccgccgccc gcgccgcttg cgaggacgcc gtgccggttc tgctccccct cacctcctcc       600
     gcccacgggc accttgtccg ctgcccctac cccgcaccgg ttcccgtcgg cgcggaccac       660
     cgaggagagc cctcatga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page