(data stored in ACNUC7421 zone)

EMBL: AP009493.PE361

AP009493.PE361       Location/Qualifiers
FT   CDS_pept        392612..393739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_361"
FT                   /product="putative peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17190"
FT                   /db_xref="GOA:B1VQ89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ89"
FT                   /protein_id="BAG17190.1"
FT                   /translation="MNTLGTSPPEPTGPAVPAVSVAGLRVHFPIRTGVLRRVTGTAHAV
FT                   DGVSFTVPARSIVTIVGESGSGKTTTGRALVGLSPITGGWVSVHGLPLDEIRRAGALPR
FT                   LAQIVYQDPYASLNPRMTIRAMIREVITVHRTTPREKTGERVEELLAQVGLRTELADRY
FT                   PHELSGGQRQRAAIARALAVEPRFIVCDEIVSALDVSIQGQIVNLLKDLRREQDVSFLF
FT                   ISHDMSVVRHISDHVIVMYGGLIMESGPCDEVFSAPRHPYTHALLAAVPVPDPRAPGLR
FT                   GGTHTRAEPPDPSGPLPGCRFQRSCAFATEVCREGAPPPAVAAGADGHTVACHHADSPG
FT                   LRAALSPKHPSTDDPKTPVAPHSTDGPATERTTAP"
     atgaacaccc tcggcacctc accccccgag cccaccggcc ctgccgtccc cgccgtctcc        60
     gtcgccggtc tgcgggtcca cttccccatc cggaccgggg tgctgcgccg ggtcaccggc       120
     accgcgcacg ccgtcgacgg ggtctccttc accgtgcccg cccgcagcat cgtcaccatc       180
     gtcggcgaga gcggaagcgg gaaaaccacc accggccgcg ccctggtcgg actgtcgccg       240
     atcaccggcg gctgggtcag cgtccacggc ctgcccctgg acgagatccg ccgcgcgggg       300
     gcgctgcccc ggctcgccca gatcgtctac caggacccgt acgccagcct caacccgcgg       360
     atgaccatca gggcgatgat ccgcgaggtc atcaccgtcc accggacgac tccccgcgag       420
     aagaccgggg agcgggtgga ggaactcctc gcgcaggtcg gcctgcgcac ggagctcgcc       480
     gaccgctatc cccatgaact ctccggcggc cagcgccagc gcgccgccat cgcccgcgcc       540
     ctggcggtcg agccccgctt catcgtctgc gacgagatcg tctccgcgct cgacgtcagc       600
     atccagggcc agatcgtcaa tctcctcaag gacctccgcc gcgaacagga cgtcagcttc       660
     cttttcatct cccacgacat gagcgtggtc cggcacatct cggaccatgt catcgtcatg       720
     tacggcggcc tgatcatgga gagcggcccc tgcgacgagg tgttctccgc gccccgccac       780
     ccctacaccc acgcgctcct cgcggccgtg ccggtgcccg acccccgggc cccgggcctc       840
     cggggcggga cgcacacgcg cgcggagccc cctgacccgt ccggtccgct gcccgggtgc       900
     cggttccagc gctcctgtgc gttcgccacc gaggtgtgcc gcgagggcgc accgcccccg       960
     gccgtcgccg ccggagcgga cggacacacg gtggcgtgcc accacgccga cagccccggc      1020
     ctacgggccg ccctctcccc gaagcacccc tccacggacg acccgaagac cccggtagcc      1080
     ccgcacagca cggacggccc ggccacggaa aggaccaccg ctccatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page