(data stored in ACNUC7421 zone)

EMBL: AP009493.PE369

AP009493.PE369       Location/Qualifiers
FT   CDS_pept        402140..403897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17198"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQ97"
FT                   /protein_id="BAG17198.1"
FT                   /translation="MSRRLTRLAGWAACGLLGAAVLPAAVSTAAEPAPAAPVRAAVVAA
FT                   DPAYDVLVFSKTAGFRHSSIDEGITALRQLGTANNFTVTATEDATAFTPANLSGYEAVV
FT                   FLSTTGDVLNTAQQTAFEGYIRSGGGYVGIHAAADTEYDWTWYSGLAGALFKSHPHIQP
FT                   ATVKVEDRAHDATAHLGSTWQRTDEWYDYRTNPRTSAHVLASLDESTYSGGTMGGDHPI
FT                   AWCKDYEGGRAFYTGGGHTEDSYADPVFRRHLLGGIRWAAETTEADCRPETGYTTLFGT
FT                   SGTTGWKQAGPGSFTNADNTLTSRGGLGLFWYQAKEYRSYSLKLDWRQAGDDNSGVFVG
FT                   FPASDDPWSAVDNGYEIQIDATDTPDRTTGSVYGFKSADLAARDAALNPPGEWNTYEIR
FT                   VEGEHLQIFLNGRKINDFTNTDPARSLQQGHIGLQNHGEGDDVSFRNIRVKELGGTTGP
FT                   REGAVTGIGGKCVDVAGGSSADGTQIQLWTCNRTARQNWTVGTDDTLRALGKCLDVSGA
FT                   GTADGTKIQLYGCNGTGAQKWVAQADGTVKNPASGKCLDASGVSSADGTRLHLWTCHTG
FT                   ANQKWALPG"
     atgagccgac gactcacccg tctcgccggc tgggccgcct gcggcctgct cggcgcagcc        60
     gtcctgccag cggcggtctc caccgccgcc gaaccggccc cggccgcccc cgtccgcgcg       120
     gcggtggtcg ccgccgaccc cgcgtacgac gtgctggtct tctccaagac cgccggcttt       180
     cgccactcct ccatcgacga gggcatcacc gccctgcgcc agctgggcac cgccaacaac       240
     ttcaccgtca ccgcgacgga ggacgccacc gccttcaccc ccgccaatct cagcggttac       300
     gaggccgtcg tcttcctctc caccaccgga gacgtcctca acaccgccca gcagaccgcc       360
     ttcgagggat acatccggtc gggcggcggc tatgtcggca tccacgcggc ggccgacacc       420
     gagtacgact ggacctggta cagcggcctg gccggcgccc tgttcaagtc ccacccgcac       480
     atccagccgg ccaccgtgaa ggtggaggac cgcgcgcacg acgccaccgc ccacctcggc       540
     tccacctggc agcggaccga cgagtggtac gactaccgca ccaacccccg cacgtcggcc       600
     cacgtcctgg cctcgctcga cgagtccacc tacagcggcg gcaccatggg cggcgaccac       660
     cccatcgcct ggtgcaagga ctacgaggga gggcgcgcct tctacaccgg cggcggccac       720
     accgaggact cctacgccga ccccgtcttc cgccgtcatc tgctcggcgg catccgctgg       780
     gccgcggaga cgacggaggc cgactgccgc ccggagaccg gctacaccac cctgttcggc       840
     acctccggga ccaccggctg gaagcaggcc ggtccgggct ccttcaccaa cgccgacaac       900
     accctgacct cccggggcgg cctcggcctg ttctggtacc aggcgaagga gtacaggtcc       960
     tactccctga agctcgactg gcgccaggca ggtgacgaca actccggtgt cttcgtgggc      1020
     ttcccggcct ccgacgatcc gtggtcggcc gtcgacaacg ggtacgagat ccagatcgac      1080
     gccaccgaca cccccgaccg caccaccggc tccgtctacg ggttcaagtc cgccgacctg      1140
     gcggcccggg acgcggccct caacccgccg ggcgagtgga acacgtacga gatccgggtc      1200
     gagggcgagc acctccagat cttcctcaac ggccgcaaga tcaacgactt caccaacacc      1260
     gaccccgccc gcagtctcca gcaggggcac atcggcctgc agaaccacgg cgagggcgac      1320
     gacgtgtcct tccgcaacat ccgcgtcaag gagctcggcg gcacgaccgg cccccgggaa      1380
     ggggctgtca ccggcatcgg cggcaagtgc gtcgacgtgg cgggcgggtc gagcgccgac      1440
     ggcacacaga tccagctgtg gacctgcaac cggacggccc gccagaactg gacggtcggt      1500
     acggacgaca cgctgcgggc gctcggcaag tgcctggacg tcagcggcgc gggaacggcc      1560
     gacggcacga agatccagct gtacgggtgc aacggcacgg gcgcccagaa atgggtggca      1620
     caggccgacg gaacggtgaa gaacccggcg tccggcaagt gcctggacgc gtcaggggtc      1680
     tcctcggcgg acggcaccag gctccacctg tggacctgcc acaccggtgc caaccagaag      1740
     tgggcgctcc ccggctga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page