(data stored in ACNUC7421 zone)

EMBL: AP009493.PE37

AP009493.PE37        Location/Qualifiers
FT   CDS_pept        complement(41215..41361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_37t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_37t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16866"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKM1"
FT                   /protein_id="BAG16866.1"
FT                   /translation="MTDTPRVYEIANRNSGLLLRADTNAPTVIKQYRAQDDHRDRQWQL
FT                   LPV"
     gtgaccgaca ccccgcgggt ctacgagatc gcgaaccgca acagcgggct cctcctgcgc        60
     gccgacacca acgcccccac ggtgatcaag cagtacagag cgcaggacga ccaccgcgac       120
     cgccagtggc aactgctccc tgtgtga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page