(data stored in ACNUC7421 zone)

EMBL: AP009493.PE374

AP009493.PE374       Location/Qualifiers
FT   CDS_pept        409489..409839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17203"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA2"
FT                   /protein_id="BAG17203.1"
FT                   /translation="MWLFGPRRPEAQAAFDRELLSPRVVAAGVLGGQVARDGDGLFPAQ
FT                   RTAPAHVPGDVVGVEAEGVGGAGCAEQPEAGRWVVSDHARPWRRGPAGPRRRVHRAGRA
FT                   GVAATGRIAYGR"
     gtgtggctgt tcgggccacg gcgccccgaa gcgcaggctg ccttcgaccg cgaactcctc        60
     tccccccggg tcgtcgccgc cggggtcctc ggcgggcagg tcgcccgcga cggcgacggc       120
     ctgttcccgg ctcagcggac ggccccagcg cacgtgccgg gggacgtcgt cggcgtcgag       180
     gcggaaggcg taggaggtgc cgggtgtgcg gagcagccgg aggcgggccg ctgggtcgtg       240
     agcgatcacg cgcgtccttg gaggcgaggg ccggccggtc ctcgaaggcg agtgcaccgg       300
     gcgggtcggg caggggtcgc cgcaaccggc cggatcgcgt acgggcgctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page