(data stored in ACNUC7421 zone)

EMBL: AP009493.PE375

AP009493.PE375       Location/Qualifiers
FT   CDS_pept        complement(409863..411932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17204"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA3"
FT                   /protein_id="BAG17204.1"
FT                   /translation="MVIVQPLRRRLGSVTVASLLLAVLALVLGPVPDSAAQSNWWEPSA
FT                   RPAPDAQIGVTGEPFQGTDAQGRVRGFVDAHDHIMSNEGFGGRLICGKPYSERGVADAL
FT                   KDCPEHYPDGSLAVFDMITKGGDGRHDPVGWPTFKDWPAHDSLTHQQNYYAWIERAWRG
FT                   GQRVLVNDLVTNGVICSVYFFKDRGCDEMDAIRLEAKKTYEMQDYIDTMYGGPGKGFFR
FT                   IVTSSAQARRIVEQGKLAVVLGVETSEPFGCKQILDVAQCGKEDIDRGLDELKELGVSS
FT                   MFLCHKFDNALCGVRYDSGALGTAINVGQFLSTGTFWKTETCRGPQHDNPIGNAAAPEA
FT                   EKRLPQGVDVPSYGSDAQCNTRGLTDLGAYAMRGMMKRGMMLELDHMSVKAAGQAFDIL
FT                   ESESYPGAISSHSWMDLGWTERLYKLGGFAAQYMGASEGFVKEAERTRALREKYKVGYG
FT                   YGTDMNGVGGWPAPRGADAPNPVTYPFRSTDGGSVVDELTTGSRTWDFNTAGGAHYGMV
FT                   PDWIEDIRRVGGQKVVDEMFTGAESYLRTWAGSESYEPGENVARGASATASSAQWWNPF
FT                   EDFKAHRAVDGDTGTRWASEWKDDQWLRIDLGSAKPVGRVTLDWEEAYAKSYRVDLSDD
FT                   GSNWRTVWSTDVGDGGLDTARFTAAQARYVRVTGLKRGTQWGYSLREVGVHAAG"
     atggtcatcg ttcaaccctt gcggcgcaga ctcggttccg tcacggtcgc gtcgttgctg        60
     ctcgccgtgc tggccctggt tctcgggccg gtgcccgact ccgcggcgca gtccaactgg       120
     tgggagccgt cggcacggcc cgctcccgac gcgcagatcg gtgtcaccgg cgagcccttc       180
     caaggcaccg acgcccaggg gcgcgtccgg ggcttcgtcg acgcccacga ccacatcatg       240
     tccaacgagg gcttcggagg acggctgatc tgcggaaagc cgtactcgga acggggcgtg       300
     gccgacgcgc tcaaagactg ccccgagcac tatcccgacg gctccctcgc cgtcttcgac       360
     atgatcacca agggcggcga cggcaggcac gaccccgtcg gatggcccac gttcaaggac       420
     tggcccgccc atgactcgct gacccaccag cagaactact acgcctggat cgagcgggcc       480
     tggcgcggcg gccagcgcgt gctggtcaac gacctggtca ccaacggcgt gatctgctcc       540
     gtgtacttct tcaaggaccg cggctgcgac gagatggacg ccatccgtct cgaggcgaag       600
     aagacgtacg agatgcagga ctacatcgac acgatgtacg gcggcccggg caagggcttc       660
     ttccgcatcg tcaccagcag cgcgcaggcc cggcggatcg tcgagcaggg caagttggcc       720
     gtcgtcctgg gcgtggagac ctccgagccg ttcggctgca agcagatcct ggacgtagcg       780
     cagtgcggca aggaggacat cgacaggggc ctggacgaac tgaaggaact gggcgtcagc       840
     agcatgttcc tgtgccacaa gttcgacaac gccctgtgcg gtgtgcgcta cgactccggt       900
     gccctcggca cggccatcaa cgtgggccag ttcctgtcga cgggcacgtt ctggaagacg       960
     gagacctgcc gtggaccgca gcacgacaac cccatcggca acgcggccgc gccggaggcg      1020
     gagaagcggc ttccgcaggg cgtggacgtc ccctcgtacg gttcggacgc ccagtgcaac      1080
     acccgcgggc tgaccgacct gggcgcgtac gcgatgcgcg gcatgatgaa acgcggcatg      1140
     atgctggagc tcgaccacat gagcgtcaag gccgcaggcc aggcattcga catcctggag      1200
     tccgagtcgt acccgggcgc catctcctcg cacagctgga tggacctggg ctggaccgaa      1260
     cgcctgtaca agctcggcgg gttcgccgca cagtacatgg gcgcctccga ggggttcgtc      1320
     aaggaggccg agcgcacgcg ggcgctgcgc gagaagtaca aggtgggcta cggctacggc      1380
     accgacatga acggcgtcgg cggctggccg gccccgcgcg gcgcggacgc cccgaacccg      1440
     gtgacgtacc ccttccgcag tacggacggc ggctcggtcg tcgacgaact gaccaccgga      1500
     tcgcgcacgt gggacttcaa caccgccggt ggcgcgcact acggcatggt tccggactgg      1560
     atcgaggaca tccggagggt cggcggccag aaggtcgtcg acgagatgtt cacgggcgcc      1620
     gagtcctacc tgcgcacctg ggccggttcc gagagctacg agcccgggga gaacgtcgcc      1680
     aggggcgcgt ctgccacggc gtcctccgcg cagtggtgga accccttcga ggacttcaag      1740
     gcccaccggg cggtggacgg cgacacgggc acccgctggg ccagtgagtg gaaggacgac      1800
     cagtggctgc ggatcgacct cggatcggcg aagccggtcg ggcgcgtcac cctcgactgg      1860
     gaggaggcgt atgcgaagtc gtaccgcgtc gacctgtcgg acgacggctc caactggcgg      1920
     acggtgtggt ccaccgacgt cggtgacgga ggtctggaca cggcccgctt caccgcggcc      1980
     caggcacgct acgtacgcgt gacagggctg aagcgcggta cccagtgggg ctactcgctg      2040
     cgcgaggtcg gcgtccacgc cgccggctga                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page