(data stored in ACNUC7421 zone)

EMBL: AP009493.PE376

AP009493.PE376       Location/Qualifiers
FT   CDS_pept        412234..412695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17205"
FT                   /db_xref="InterPro:IPR025851"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA4"
FT                   /protein_id="BAG17205.1"
FT                   /translation="MNDAEAASLLAGCARFPYPGAWQDSPFAGRTVGGARYAVVAVDPG
FT                   LSVLGLRRDDGSLWCLPEDGAPRLVNSSVEAFVAFNRAYEEAAAEAAAYEGPGDGLDED
FT                   EAVDLAEEAADALTEALLERFGMLDAEAVADENSFWHIGAEELGYGMSV"
     atgaacgacg ctgaagccgc ctcgctcctg gccggatgtg ctcgcttccc gtaccccggg        60
     gcgtggcagg actccccctt cgcgggacgc acggtcggcg gtgcgcggta cgccgtggtc       120
     gcggtcgacc cggggctgag cgtgctcggt ctgcggcgtg atgacggctc gctgtggtgt       180
     ctgccggagg atggcgcccc tcgactggtg aactccagcg tcgaggcgtt cgtagccttc       240
     aaccgtgcct acgaggaggc cgccgccgag gccgccgcct acgaggggcc tggtgacggt       300
     ctggacgagg acgaggccgt ggacctggcc gaggaggccg ccgacgcgct cacggaagcg       360
     ttgctggaac gattcgggat gcttgacgcc gaggcggtcg ccgacgagaa ctccttctgg       420
     cacatcgggg ccgaggagct cggctacggc atgagtgtgt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page