(data stored in ACNUC7421 zone)

EMBL: AP009493.PE379

AP009493.PE379       Location/Qualifiers
FT   CDS_pept        414124..414531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17208"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA7"
FT                   /protein_id="BAG17208.1"
FT                   /translation="MSVRKKTALALAAVTLTTGLATGAGAATAAPASASASASASGQRA
FT                   AVECGVRADGKLWCGNRVGAKGYEHRTYRSGVRGSLTSSFSWFVCWGPGDNHAGGNNIW
FT                   YWTLLDNGQWGNVPAVDVHTPSDPWGNLRQC"
     gtgtccgtac gcaagaagac agccctggct ctcgcagccg tcaccctgac cacgggtctg        60
     gccaccgggg caggcgccgc caccgcagcc cccgcctccg cctccgcctc cgcctccgcc       120
     tccgggcagc gcgccgccgt cgagtgcggt gtccgcgccg acggcaaact gtggtgcggc       180
     aaccgcgtcg gtgccaaggg ctatgagcac cgcacgtaca ggtcaggggt caggggctcg       240
     ctgacctcga gcttcagttg gttcgtctgc tggggccccg gcgacaacca tgccggcggg       300
     aacaacatct ggtactggac gctgctcgac aacggtcagt ggggcaacgt cccggccgtg       360
     gacgttcaca ctccctccga cccctggggg aacctgcgtc agtgctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page