(data stored in ACNUC7421 zone)

EMBL: AP009493.PE381

AP009493.PE381       Location/Qualifiers
FT   CDS_pept        415890..416564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17210"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQA9"
FT                   /protein_id="BAG17210.1"
FT                   /translation="MTAAVAALALALVNPASAAAPAPSEQVAASVGPVQLYIGGLGSGP
FT                   YNVAVQSAVGTAMDNAVSKGFDPARCNLVKGPTVVNQLPNGYVQVAVEYLCAGDPYVPG
FT                   PTFVLNRYHKSSDTQSNSWYHPNGYQLQGPLGSLYTYAAAGTTPLYLCQVRGDHFTSTD
FT                   VACEGQQYVTRLGWLYTTQPAGVATVPLFRCLRNENRQIFDSIQSNCEGQIHGGPLGYT
FT                   LA"
     atgaccgcgg ccgtcgccgc gctcgccctg gctctcgtca acccggcatc cgccgccgcc        60
     ccggccccgt ccgagcaggt ggccgcttcc gtcggaccgg tacagctcta catcgggggc       120
     ctgggaagcg gcccgtacaa cgtcgcggtt cagtcggccg tcggcaccgc gatggacaac       180
     gccgtgtcca aggggttcga ccccgctcgg tgcaacctgg tcaagggccc cacggtcgtc       240
     aaccagctcc cgaacggata tgtgcaggtg gcggtcgagt atctctgtgc gggagatccg       300
     tacgttcccg ggcccacctt cgtcctgaac cgctaccaca agagctccga cacccagagc       360
     aacagctggt accaccccaa cggctaccag cttcagggcc cgctcggttc gctgtacacc       420
     tatgcggccg cgggcaccac gccgttgtac ctctgccagg tgaggggcga ccacttcacc       480
     agcaccgacg tcgcctgtga gggccagcag tatgtgacgc gtctcggttg gctctacacc       540
     acccagccgg ctggagttgc cacggttccc ctgttccgat gcctgcggaa cgagaaccgc       600
     cagatcttcg actccatcca gtcgaactgt gaaggccaga tccacggagg cccgctgggg       660
     tacaccctgg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page