(data stored in ACNUC7421 zone)

EMBL: AP009493.PE382

AP009493.PE382       Location/Qualifiers
FT   CDS_pept        complement(416939..417763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17211"
FT                   /db_xref="GOA:B1VQB0"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB0"
FT                   /protein_id="BAG17211.1"
FT                   /translation="MVSIGVPLAIFLALPILVSEVSEEIARILPAPTSPVAVAAIVGSL
FT                   ALTAFLIAYFRPERTDRAEGESRQRLAQAEFALADALRGTHSFETGTPVPHARADEHGG
FT                   TAADEASYRRRLLGLPELWEATHARLDLYHRIATSQAETSFRNAQRAMVAGFLLLILFA
FT                   GIALWASTTAVAIVAGGLGAVSAALAGYVAKTFIRSQEAAATHLRSYFDQPLELSRYLA
FT                   AERLVADGDLSQEQRGEILSALVQAMATGPQPPPAAPQSVVVASVPGQQAAA"
     gtggtctcca tcggcgtgcc cctcgcgatc ttcctcgccc taccgatcct cgtctccgag        60
     gtcagtgagg aaatcgccag aatccttcca gcacccacga gcccggtcgc tgtcgccgcg       120
     atcgtgggca gcctcgcgct gactgccttc ttgatcgcat acttccgacc cgagcgcacc       180
     gaccgagcgg aaggcgaaag ccggcaacga ctggcccaag cggagttcgc cctcgccgat       240
     gccctccgcg gtacccactc cttcgaaacc ggcactccgg ttccccacgc gcgagctgac       300
     gaacacggtg gcaccgcggc tgacgaggca tcctaccggc gaagacttct ggggctgccc       360
     gaactctggg aagcgaccca tgcccgcctc gacctctacc accgcatcgc gaccagccag       420
     gcggagacct cgttccgcaa cgcccagaga gccatggtcg cagggttcct gcttctgatc       480
     ctcttcgcgg gcatcgccct ctgggcgagc acgactgccg tggcgatcgt cgccggcggc       540
     ctcggcgccg tgtccgcagc tctcgccgga tacgtcgcca agacgttcat ccgctcccaa       600
     gaagccgcgg ccacccacct tcggtcctac ttcgaccagc ccctcgaact ctcccgctac       660
     ctcgccgccg aacgcctcgt agccgacggg gacctctcgc aagagcaacg gggcgagatc       720
     ctctccgccc tcgtccaggc catggccacc gggccgcaac cgccgcccgc agcaccacag       780
     tccgtcgtcg tcgcgtcggt gccgggacag caagcggcgg catag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page