(data stored in ACNUC7421 zone)

EMBL: AP009493.PE383

AP009493.PE383       Location/Qualifiers
FT   CDS_pept        complement(417813..418058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17212"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB1"
FT                   /protein_id="BAG17212.1"
FT                   /translation="MRRPSVPHREHGSYGTTSSTYADLPAGRERNGALTADDLPTAPAP
FT                   IGRGAPSRREGPVRRNRWTPWPVPGMLLIHAAQQSA"
     gtgcggcgcc cctcggtgcc gcaccgcgag cacggctcgt acggcacgac cagcagcacg        60
     tacgccgacc ttcccgccgg gcgggagaga aacggtgcac tgacagcgga cgatttgccg       120
     accgcgccgg ccccgatcgg gagaggggca cccagcaggc gcgaagggcc ggttcggagg       180
     aaccggtgga cgccctggcc cgtgccgggc atgctcttga tccatgccgc ccagcaatca       240
     gcctga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page