(data stored in ACNUC7421 zone)

EMBL: AP009493.PE384

AP009493.PE384       Location/Qualifiers
FT   CDS_pept        complement(418079..418528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_384"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17213"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB2"
FT                   /protein_id="BAG17213.1"
FT                   /translation="MSKIEESVEVAVPVRTVYDQWTQFEEFPKFMEGVQRIEQRTPTLT
FT                   HWVTKVDGVGREFDAEITEQIPDERVAWTTVAGEVRQAGVVTFHRLDDTHTKVMLQLDH
FT                   DPQGIADTVGDKLGFVRRQAKSDLKNFKEFIEARGNATGAWRGTN"
     atgtcgaaga tcgaggagtc cgtcgaggtc gccgttccgg tgcgtacggt ctacgaccag        60
     tggacgcagt tcgaggagtt ccccaagttc atggagggcg tgcagcgcat cgagcagcgc       120
     acgcccaccc tgacgcactg ggtgaccaag gtagacggtg tggggcggga gttcgacgcg       180
     gagatcaccg agcagatccc cgacgagcgg gtggcctgga ccacggtggc gggcgaggtc       240
     cgtcaggcag gtgtggtcac cttccaccgc ctggacgaca cgcacaccaa ggtcatgctc       300
     cagctcgacc acgatcctca ggggatcgcc gacacggtgg gggacaagct cggcttcgtc       360
     cgccggcagg ccaagagcga cctgaagaac ttcaaggagt tcatcgaagc ccggggcaac       420
     gcgacggggg cctggcgggg caccaactga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page