(data stored in ACNUC7421 zone)

EMBL: AP009493.PE385

AP009493.PE385       Location/Qualifiers
FT   CDS_pept        complement(418679..421909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17214"
FT                   /db_xref="GOA:B1VQB3"
FT                   /db_xref="InterPro:IPR003539"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB3"
FT                   /protein_id="BAG17214.1"
FT                   /translation="MKIFGRIAAAVVAVSLLLLGVAAPTSAAPGEIQGKKFATWNLQGG
FT                   TDGTDSKWTTGVQRLVFGYGSEVSAHNVVALQEAGSRPPGTHRNIVASSVIAGQTYEVA
FT                   ETLWQVDGEHRYIYFMETDPTGHRVNLAMVTDRVPDAVYIVPGSSSIERSRPSFGVRFG
FT                   SNIFWTVHALSGGGNDAPAYIRNMNALAGVHYSWLAMGDFNQDPAALRERMPRGGTDFP
FT                   LAHVEDSGDNTYQGASELDYAVGSIDLAAGVTAHVLPNLAGSDHWPVEFRPLPELSDED
FT                   VAVRVMPVGDSITYGVGSLDVNGYREELYGGLAYMDLDPDFIGSNSSGSMGDPQHNGHR
FT                   GYKIDDITEIVKRDTGVMRPNVVTLMAGTNDVQSNADVAGAPARLGKMIDTLQAESPGV
FT                   AIAVATLVPIKNDPAAQTRRDAFNVEVRALVKDRQARGQRVELAEFGPMTDAMLFDRLH
FT                   PNDRGYAYMAEEFFQAVMTMRAKGWIEKAGSGGDGSGCPAPGGGWGELGRIAQGPAEAA
FT                   AKDVHGEVRLPDLNGDGRADYAVLTKSGEVYLWTRTTEGWSNRGRVADGTGAAADRVRF
FT                   ADMDGDGDDDYLVVDDEGVVTAWRNDGVADRGGAWKAMGVIADRSGNTVPQELGPGKYV
FT                   QFADIDGDGDDDYLVVHPHEVLGQKGVIWGWLNDGVFQHGRSAWKFVGWIGHHKSDSEG
FT                   PADVRLADMDGDGDADYLIVSESGAVNVRRNNLGSDPEKWLYEWGESSPIAKGTGIGGS
FT                   SVLLADADADGDADYFTRLPDGTVNWWENDEVATRPDWEHGFIRKGLYADHLKDPAAFA
FT                   RTVHFADMDADGDADYVVVGSKGEAWGWRNDDVAERGTNAWIRMGLIAEGVTPSTAERI
FT                   VFADYDGDGYDDYLVVNDRNGATRAWHNEGVFTKGVTAWTSRGTMAHGPAAAAHGEVRF
FT                   ADIDADGRDDYLVVAPDHSVQAWKNQGTNAGDGGGWATPVLLARPSTYGAGQQTMFANL
FT                   NCDGRADYVLRDPAANNLLYGWFNLGDFTNNWSPKKKVAHGVAMGFPVDIHLADLSGDG
FT                   ADDYLVVDPENGATRAWLNKGGNQADPG"
     gtgaaaatct tcggacggat cgcagccgcc gtggtggccg tatcgctcct gctgttaggg        60
     gtcgctgctc ccacgagcgc cgccccggga gagatacagg ggaagaagtt cgcgacctgg       120
     aatctccagg gaggcaccga tggcaccgac tcgaagtgga cgacgggtgt gcagcggctg       180
     gtcttcgggt acggctccga ggtatcggcg cacaacgtgg tggctttgca ggaagccggt       240
     tcgcggccgc cggggaccca tagaaacatc gtcgcgagca gcgtgatcgc cgggcagacc       300
     tacgaggtcg ccgagacgct gtggcaggtg gacggcgagc atcggtacat ctacttcatg       360
     gagaccgacc ccacggggca ccgggtcaat ctggcgatgg tgaccgaccg ggtccccgat       420
     gccgtctaca tcgtccccgg atcgagttcc atcgagcgca gccgtccgtc cttcggtgtc       480
     cggttcggtt cgaacatctt ctggaccgtg cacgccctgt cgggcggtgg gaacgatgcc       540
     ccggcctaca ttcgcaacat gaacgccctg gcaggcgttc actacagttg gctggcgatg       600
     ggcgacttca accaggaccc ggcggcactg cgcgagcgga tgcccagagg gggcacggac       660
     tttcctctcg cacacgttga ggactccggg gacaacacct accagggcgc gtccgaactc       720
     gactatgcgg tcggatccat cgatctggcc gccggtgtga cggcacatgt gctgccgaac       780
     cttgcgggat ccgatcactg gccagtcgag ttcaggcctc ttccggagct gtccgacgaa       840
     gatgtggccg tccgggtgat gcccgtcggc gactcgatca cctatggcgt gggctccttg       900
     gacgtcaacg gctatcgcga ggaactgtac ggcggcctcg cgtacatgga tctggatccc       960
     gacttcatcg ggtcgaactc gtcggggtcc atgggggatc cgcagcacaa cggccatcgt      1020
     ggctacaaga tcgacgacat cacggagatc gtgaagcggg acaccggtgt gatgcgtccc      1080
     aacgtggtga ccctgatggc ggggacgaac gatgtccaga gcaacgcgga tgtggcgggc      1140
     gcgcccgccc ggctcgggaa gatgatcgac acgctccagg ccgagtcccc gggcgtggcg      1200
     atcgcggtgg caaccctggt tccgatcaag aacgatcctg cggcgcagac gcgacgcgac      1260
     gcgttcaacg tcgaggtgcg ggccctggtg aaggatcgcc aggcacgcgg acagcgtgtc      1320
     gaactggctg agttcggccc gatgaccgat gccatgcttt tcgaccgtct ccaccccaat      1380
     gaccgggggt acgcgtacat ggccgaggag ttcttccagg ccgtcatgac gatgcgagcc      1440
     aagggctgga tcgagaaggc cggttcgggc ggcgacggtt cggggtgtcc cgcaccgggt      1500
     ggcggctggg gcgaactggg gcggatagcc caggggcctg ccgaggccgc cgccaaggac      1560
     gtacacgggg aggtgcggtt gccggacctc aacggggacg gccgggccga ctacgcggtc      1620
     ctcaccaaaa gcggcgaggt ctatctctgg acaaggacga cggaggggtg gagcaaccgg      1680
     ggcagggtcg ctgacggcac cggcgccgct gcggaccggg tgcgcttcgc ggacatggac      1740
     ggtgacggcg acgacgacta cctcgtggtc gacgacgagg gcgtggtgac cgcgtggcgc      1800
     aacgacggcg tcgcggaccg gggcggcgcg tggaaggcca tgggcgtcat cgccgaccgg      1860
     tcgggcaaca cggtccccca ggaactgggg ccggggaagt acgtgcagtt cgccgacatc      1920
     gacggcgacg gtgacgatga ctacctcgtc gtccaccccc atgaggttct gggccagaag      1980
     ggggtcatct gggggtggct caacgacggt gtcttccagc acggcaggag cgcgtggaag      2040
     ttcgtcggct ggatcggtca tcacaagagc gattcggaag ggccggcgga tgtccggctc      2100
     gcggacatgg acggtgacgg cgacgcggac tacctgatcg tgtccgagag cggggcggtg      2160
     aacgtacggc ggaacaatct gggcagtgac ccggagaagt ggctgtacga gtggggcgag      2220
     agcagcccca tcgccaaggg cacggggatc gggggttcgt ccgtgcttct cgccgacgcc      2280
     gatgccgacg gtgacgccga ctacttcacc cgtcttcccg atggaacggt caactggtgg      2340
     gagaacgacg aggtcgcgac ccgtccggac tgggagcacg gcttcatcag gaagggcttg      2400
     tacgccgacc acctgaaaga tcccgcggcg ttcgcccgga cggtgcactt cgcggacatg      2460
     gacgctgacg gcgatgccga ctacgtcgtc gtcggctcca agggcgaagc gtggggctgg      2520
     cgcaacgacg acgtggccga gcgtggcacg aacgcctgga tccggatggg actgatcgcc      2580
     gaaggcgtca cgccatcgac cgcggagcgg atcgtcttcg cggactacga cggggacggc      2640
     tacgacgact acctggtcgt gaacgaccgc aacggcgcga cacgggcctg gcacaacgaa      2700
     ggcgtgttca ccaagggagt caccgcctgg acgtccaggg gcacgatggc ccacggaccg      2760
     gcggcagcgg cccacggcga ggtgcggttc gcggacatcg acgccgacgg acgcgacgac      2820
     tacctggtgg tggcccccga ccactccgta caggcatgga agaaccaggg tacgaacgcc      2880
     ggggacggcg gaggctgggc caccccggtc ctgctcgccc gcccgtcgac gtacggcgcc      2940
     gggcagcaga cgatgttcgc gaacctgaac tgcgacggcc gcgccgacta cgtactgcgt      3000
     gaccccgccg cgaacaacct gctgtacgga tggttcaacc tgggcgactt cacgaacaac      3060
     tggtcgccga agaagaaggt ggcgcacgga gtcgccatgg gcttccccgt cgacatccac      3120
     ctcgcggacc tctccggcga cggcgccgac gactacctcg tcgtcgaccc cgagaacggc      3180
     gcgacccggg cctggctgaa caagggaggc aaccaggccg atcccggctg a               3231
//

If you have problems or comments...

PBIL Back to PBIL home page