(data stored in ACNUC7421 zone)

EMBL: AP009493.PE386

AP009493.PE386       Location/Qualifiers
FT   CDS_pept        422407..422748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17215"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB4"
FT                   /protein_id="BAG17215.1"
FT                   /translation="MLPPRLLWCDPRPIPRFNRQEPVTLILRDPGFHEPADEDGCTTFS
FT                   YFCRTHDRFYGRKTCGEGPHLVALHCKKHGPESMWPQPLTLLFPQGFEPSLSEAQLSWL
FT                   EAEWEAAGA"
     gtgcttcctc ctcgactgct gtggtgcgac cctcggccca tcccccggtt caaccgccag        60
     gaaccggtga cactgatcct ccgggacccc ggtttccacg agccggctga cgaggacggc       120
     tgcacgacgt tctcgtactt ctgtcggacc catgaccgct tctacggacg taaaacctgc       180
     ggggaggggc cgcatctcgt agctctccac tgtaagaagc acgggcccga aagcatgtgg       240
     ccgcaacccc tcaccctctt gttcccccaa ggctttgagc cttcgctcag cgaggctcag       300
     ctcagctggc tggaagcaga gtgggaggcc gccggagcct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page