(data stored in ACNUC7421 zone)

EMBL: AP009493.PE39

AP009493.PE39        Location/Qualifiers
FT   CDS_pept        complement(41588..42166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_39t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_39t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16868"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLW7"
FT                   /protein_id="BAG16868.1"
FT                   /translation="MGRPGALPAVYPPPLGLDLSSSAVISRFPGRWWGGSSPARDADDN
FT                   PVPARLPLPRRTLWHRARDPGDDARVINRELSSRLAAGRDRRVTQLAEAAARWGGHVPD
FT                   DPGITELADLLETAANAPDRSGNPDHPGGPGHTARALLAGAVENLRAAARLGGLLPAIT
FT                   LWHLQRAIDQEHTAHQQHTAPARRKAHDR"
     gtggggcgcc ccggggctct tcccgccgtt tacccgccac ccttaggtct agacctttcc        60
     tcgtcggcgg tgatctcccg gttccctgga cggtggtggg gcgggagcag ccccgccagg       120
     gacgcggacg ataaccctgt tcccgcccga ctgccgctcc cgcgacggac cttgtggcat       180
     cgcgcccgcg atccgggaga cgatgcccgt gtgatcaacc gggagctctc ctcacgcctg       240
     gcagccggcc gcgaccgccg tgtcacccag ctcgccgaag cagccgcccg ctggggcgga       300
     cacgtacccg acgaccccgg catcacggag ctcgccgacc tcctcgaaac cgccgccaac       360
     gcccccgacc ggtctggtaa ccccgaccac cccggcggcc ctgggcacac cgcgagggcc       420
     ctcctggccg gtgccgtcga gaacctccgg gcagccgccc ggctcggcgg cctcctcccc       480
     gccatcaccc tctggcacct ccaacgcgcc atagaccagg aacacaccgc ccaccaacaa       540
     cacaccgccc ccgcacgacg aaaagcacac gaccggtag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page