(data stored in ACNUC7421 zone)

EMBL: AP009493.PE390

AP009493.PE390       Location/Qualifiers
FT   CDS_pept        426191..426529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17219"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQB8"
FT                   /protein_id="BAG17219.1"
FT                   /translation="MEAAVFGGELRRSRLPVENMGDDDLWIFVEPYGEDYWLKPGDVFT
FT                   VAPEVEGIDVWFSTAVCPEGITVWLYEDGDPTKVVLKYTVSDADGTRLECGHQRPPKPA
FT                   GWSTPEPG"
     atggaggcag cggtctttgg gggagaattg agacgcagtc ggttgcctgt ggagaatatg        60
     ggcgacgacg acctctggat cttcgtcgag ccgtacggtg aggactactg gctgaaaccc       120
     ggggatgtct tcacggtcgc tccggaggtt gaggggatcg atgtctggtt ctctaccgct       180
     gtctgcccgg agggcatcac ggtgtggctc tacgaggacg gtgacccgac caaggtcgtc       240
     ctgaagtaca ccgtgagtga cgcggacggc acacggctgg agtgcgggca ccagagaccc       300
     ccgaagccgg cgggctggag cacgcccgag ccgggctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page