(data stored in ACNUC7421 zone)

EMBL: AP009493.PE393

AP009493.PE393       Location/Qualifiers
FT   CDS_pept        complement(427537..427815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17222"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC1"
FT                   /protein_id="BAG17222.1"
FT                   /translation="MTAARIPRQLDLQEDAARALADGLRAQIDDLQSRLRESETHLEHL
FT                   AITRRTVTGLADRLPAVVPDLHPSQAETPGQLGILTEVGTGSFARKP"
     gtgacggctg ctcggattcc caggcagctg gaccttcagg aagacgccgc gcgggccctg        60
     gcggacggtc tccgtgcaca gatcgacgac ttgcagagcc ggttgcggga gtccgagaca       120
     cacctggagc acctcgcgat cacccgcagg accgttaccg gcctcgccga ccggctcccg       180
     gctgtcgtgc cggacctgca cccgagccaa gctgaaacgc ctggtcaact cggcatcctc       240
     accgaggtcg gcaccggcag cttcgcgaga aagccctag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page