(data stored in ACNUC7421 zone)

EMBL: AP009493.PE395

AP009493.PE395       Location/Qualifiers
FT   CDS_pept        428425..428703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17224"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC3"
FT                   /protein_id="BAG17224.1"
FT                   /translation="MGEAELSVRGQKERLSSSGRNHSETSAAGTSRPPPAREEGHGFMS
FT                   AAVRATLDPTVVDPGVQGLVPAPMLGSERQLHEGMEKETPRRPTSSF"
     gtgggcgagg cggagctgag cgtgcgcggc cagaaggaac gcctgtcgtc gtccggccgc        60
     aaccacagcg agacgtctgc ggccggcacc agccgaccgc caccggctcg ggaagaggga       120
     cacgggttca tgtccgccgc agtccgggcg acgttggatc cgaccgtggt tgatcccgga       180
     gtgcaaggcc tcgtgcctgc gccgatgctc gggagcgagc gccagctcca cgaaggtatg       240
     gagaaggaga cgcctcgccg ccccacgagc tcattctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page