(data stored in ACNUC7421 zone)

EMBL: AP009493.PE396

AP009493.PE396       Location/Qualifiers
FT   CDS_pept        428773..429084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17225"
FT                   /db_xref="GOA:B1VQC4"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC4"
FT                   /protein_id="BAG17225.1"
FT                   /translation="MRPEHCVTRNHIEVWRGRVLPSGAERIRFGTVLRGSLLPILVWAG
FT                   VACLASFVYDPLVAAVLGGLFALSLIVGFALRRRAKHSVRCSVYGALGGVLDKSMAGF"
     atgcgacctg agcactgtgt gaccaggaac cacatcgagg tgtggcgagg acgagtgctg        60
     ccgtcggggg cggaacggat caggttcggg acggtgctgc gcggctcgct cctgccgatc       120
     ctggtctggg ccggagtcgc gtgcttggcg tccttcgtct acgacccgct cgtagcggcg       180
     gtcctcggcg gtctcttcgc gttgtcgctc atcgtggggt tcgcgttgcg tcgcagggcg       240
     aagcactcgg tccgctgcag cgtctacggt gcgctgggcg gagtgctcga caagtccatg       300
     gccggtttct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page