(data stored in ACNUC7421 zone)

EMBL: AP009493.PE397

AP009493.PE397       Location/Qualifiers
FT   CDS_pept        complement(429199..429561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17226"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC5"
FT                   /protein_id="BAG17226.1"
FT                   /translation="MSVPARTVEDRYRRNRAPVSERSGHMGEISVNSTALGRLLTDSTK
FT                   VRARRPYQEAFAELADTYQGRPVSEVLPLLRRAADEALLGFTDADLREQAQAIRSGEPY
FT                   VLRVRVTQAVSLASSR"
     ttgtcagtcc ccgcccgtac cgtcgaagac aggtaccgga ggaaccgggc cccagtgagc        60
     gagcggagcg ggcacatggg cgagatcagc gtgaacagca cggccctggg acggctgctc       120
     accgacagca caaaggtccg ggcccgtcgt ccgtaccagg aggccttcgc cgagctggcc       180
     gacacctacc agggaagacc ggtctcggag gtcctaccgc tgctgcgccg ggccgcagac       240
     gaggcgctgc tcggcttcac cgacgcggac ctgagggagc aggcgcaggc gatccggtcc       300
     ggcgaaccgt acgtactgcg ggtccgcgtc acccaggccg tttctcttgc atcatcgcgc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page