(data stored in ACNUC7421 zone)

EMBL: AP009493.PE398

AP009493.PE398       Location/Qualifiers
FT   CDS_pept        429928..431829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17227"
FT                   /db_xref="GOA:B1VQC6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC6"
FT                   /protein_id="BAG17227.1"
FT                   /translation="MTSSSSASKPAQPFIARQNAALRERLPFSDTQDFQDAARGLIGRR
FT                   EPNAVTAQDGHVVWDNDSYSFLTGEVPETVNPSLWRQSQLVAEHGLFEVVEGIYQVRGL
FT                   DLSNVTFVEGTTGIVVIDPLLSTETAAAALALYREHRGERPVTGVVYTHSHVDHFAGVK
FT                   GVTTQDDVDAGRVPVLAPEGFIEHAVAENVYAGTAMARRAAYMYGAALARGPQGQVGAG
FT                   LGQTTATGTVSLIAPTLEITTTGQEETVDGVRMVFQMAPDTEAPSEMLIHFPDLRALCT
FT                   AEDATHTLHNLLTLRGAVVRDPHNWSRYLTETIDLFADSTDVAFASHHWPTWGQENIKR
FT                   FLGIQRDLYGYLHDQTLRLINKGWTGTEIAEHLQLPPALEKTWSTHGYYGSVSHNLKAV
FT                   YQRYMGWFDGNPAHLWQHTPTEAAKRYVDFMGGADTVVDKARASFESGDLRWAAEVLNH
FT                   VVFARPDHAAARELLADTYEQLGYGAENGTWRNFYLSGTAELRQGQFGTPTVTASADII
FT                   ANLSPRLLFDALAVQINGPKAWDEHITIAVALTDTGEEYRLRLANGVLTHTAAPQRDAA
FT                   DVTLTTTSRRLPALALGKLMPQALADAGIRTDGDTSVLERLAAVLDPGDSDFPIVTP"
     atgacttcct cttcgtcggc gtcgaagccc gcgcagccct tcatcgcccg gcagaacgcc        60
     gctctccgcg agcgcctgcc gttctcggac acgcaggatt tccaggatgc cgctcggggc       120
     ctgatcggac ggcgggagcc gaacgcggtg acagcccagg acggccacgt cgtgtgggac       180
     aacgactcct attcgttcct cacgggcgag gtacccgaga cggtcaaccc ctcgttgtgg       240
     cgtcagtccc agctcgtggc cgagcacggg ctgttcgagg tcgtcgaggg catctaccag       300
     gtgcggggcc tggacctgtc gaacgtgacg ttcgtcgagg gcacgacggg catcgtcgtg       360
     atcgacccgc tgctgtccac ggagaccgct gctgccgcgc tcgccctgta ccgcgagcac       420
     cgcggcgagc gccccgtcac cggtgtggtc tacacccact cccatgtgga ccacttcgcc       480
     ggcgtcaagg gcgtcaccac ccaggacgac gtggacgcgg gccgggtgcc ggtgctggca       540
     ccggaggggt tcatcgagca cgcggtggcg gagaacgtgt acgcgggtac cgccatggcg       600
     cggcgcgccg cctacatgta cggggccgcg ctcgcccggg gcccccaggg ccaggtcggt       660
     gcgggcctgg gacagaccac cgctaccggc accgtcagcc tcatcgctcc gaccctggag       720
     atcaccacga cgggccagga ggagacagtg gacggggtgc ggatggtctt ccagatggcc       780
     ccggacaccg aggcgccatc ggagatgctc atccacttcc ccgatctgcg ggctctgtgc       840
     acggccgagg acgccaccca caccctgcac aacctgctga cgctgcgcgg ggccgtggtc       900
     cgcgacccgc acaactggtc gcggtacctc accgagacga tcgacctgtt cgccgacagc       960
     acggatgtgg cgttcgcctc gcaccactgg cccacctggg gccaggagaa catcaagcgg      1020
     ttcctcggca tccagcgcga cctgtacggc tacctccacg accagacgct gcgcctgatc      1080
     aacaagggct ggaccggaac cgagatcgcc gagcacctcc agctcccgcc cgccctggag      1140
     aagacctggt ccacccacgg ctactacggc tcggtcagcc acaacctcaa ggccgtctac      1200
     cagcgctaca tgggctggtt cgacggcaat cccgcccacc tgtggcagca cacccccacc      1260
     gaggccgcca agcgctacgt ggatttcatg ggcggcgccg acacggtcgt ggacaaggcc      1320
     cgcgcctcct tcgagtccgg tgacctgcgc tgggccgccg aagtcctcaa ccacgtcgtc      1380
     ttcgcccggc ccgaccacgc ggcggcccgt gaactcctcg ccgacaccta tgaacagctc      1440
     ggctacgggg cggagaacgg cacctggcgc aacttctacc tctcgggcac tgccgaactc      1500
     cgccagggcc agttcggcac cccgaccgtc accgcctccg ccgacatcat cgccaacctc      1560
     agcccccgac tcctcttcga cgccctcgcc gtccagatca acggacccaa ggcgtgggac      1620
     gagcacatca ccatcgcggt cgccctgacc gacaccggcg aggagtaccg gctgcggctg      1680
     gccaacggcg tgctcaccca caccgccgcc cctcagcggg acgccgccga cgtcaccctc      1740
     accaccacca gccgccggct tcccgcgctc gccctgggca aactgatgcc ccaggcactg      1800
     gcggacgcag gcatccggac cgatggcgac acctcagtcc tcgaacgact cgcggccgtt      1860
     ctcgaccccg gtgacagcga ctttccgatc gtcacaccct ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page