(data stored in ACNUC7421 zone)

EMBL: AP009493.PE400

AP009493.PE400       Location/Qualifiers
FT   CDS_pept        432953..434482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_400"
FT                   /product="putative amino acid transport integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17229"
FT                   /db_xref="GOA:B1VQC8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQC8"
FT                   /protein_id="BAG17229.1"
FT                   /translation="MSLESITENVDDAVSGFFEPIAKWLGEIVFYAVPVGGTDLPLIVA
FT                   WLVVAGLVFTGWFGFVQLRKFRLAVDVVRGKYDDTDSAGEVNHFQALTAAVSGTVGLGN
FT                   IAGVAVAVSIGGAGATFWMILCGLLGMATKFVEVTLGVKYREVHSDGTVSGGPMHYLPK
FT                   GLAERFGKNGKAFGKVLAVLASIMILFFGLFGGNLFQVNQSYAQLVSVTGGEDGAMGSS
FT                   AGALFFGILVAALVGIVLLGGIRSIASVTSRLIPAMAGIYIVACLVVILVNVTAVPAAI
FT                   GTIIEGAFNPEGVAGGVLGALIIGFKRAAFSNEAGLGSAPIAHSAVKTKHPASEGLVAL
FT                   LEPFIDTVVICTMTALTIVIANPASWGEARTDESIGGVTITSDAFETVLPWFPYVLTVA
FT                   VLLFAISTVLTWGYYGLKAWTYLFGRSTVSETVYKSLYTLFAVAGSLLTLQTLIDLADA
FT                   VLFSLAVINIIGLYLLAPVVKRELNTFLAYVRERESTPAARDEDERLKTGH"
     gtgtcactcg aatccataac cgagaacgtc gacgatgccg tcagcgggtt cttcgagccc        60
     atagccaagt ggctcggaga gatcgtcttc tacgccgtcc ccgtcggcgg gacggacctc       120
     ccgctcatcg tcgcctggct ggtggtggcg ggcctcgtct tcaccggctg gttcgggttc       180
     gtccagctgc gaaagttccg cctcgccgtc gatgtggtgc gcggcaagta cgacgacacg       240
     gactcggcgg gcgaggtcaa ccacttccag gcgctgaccg ccgccgtctc cggcacggtc       300
     ggcctcggca acatcgccgg tgtcgcggtc gccgtctcca tcggtggcgc cggggccacg       360
     ttctggatga tcctctgcgg cctcctcggc atggccacca agttcgtcga ggtcaccctc       420
     ggagtgaaat accgcgaggt ccactccgac ggcaccgtct ccggcgggcc gatgcactat       480
     ctgcccaagg ggctggcgga acgcttcggg aagaacggca aggcattcgg caaggtcctc       540
     gccgtcctcg cctcgatcat gatcctgttc ttcggcctct tcggcggcaa cctgttccag       600
     gtcaaccagt cctacgccca gctcgtctcc gtcaccggcg gcgaggacgg ggcgatgggc       660
     tcctcggccg gggcgctctt cttcggcatc ctcgtcgccg ccctggtcgg catcgtgctc       720
     ctcggcggca tccgctcgat cgcgtcggtc accagtcggc tcatccccgc gatggcgggt       780
     atctacatcg tcgcctgcct cgtcgtcatc ctcgtcaacg tcaccgccgt gcccgccgcg       840
     atcggcacga tcatcgaagg cgccttcaac cccgaaggcg tcgcgggcgg tgtgctcggc       900
     gcactgatca tcgggttcaa gcgggcggcg ttctccaacg aggccggtct cggctccgcg       960
     ccgatcgccc actccgcggt caagaccaag caccccgcca gcgagggcct ggtggcgctc      1020
     ctggagccgt tcatcgacac cgtcgtcatc tgcaccatga ccgcgctgac catcgtcatc      1080
     gccaacccgg ccagctgggg cgaggcccgc accgacgagt ccatcggtgg cgtgacgatc      1140
     acctcggacg ccttcgagac cgtgctgccc tggttcccgt acgtcctgac ggtcgccgtg      1200
     ctgctcttcg cgatctccac ggtcctcacc tggggctact acggtctcaa ggcctggacg      1260
     tacctcttcg gccgcagcac cgtcagcgag accgtctaca agtccctcta cacgctgttc      1320
     gccgtcgccg ggtccctgct caccctgcag accctcatcg acctggccga cgcggtgctc      1380
     ttctccctgg ccgtcatcaa catcatcggc ctctacctcc tcgcacccgt cgtcaagcgc      1440
     gagttgaaca ccttcctcgc ctacgtccgc gagcgcgaat cgactccggc cgctcgcgat      1500
     gaggacgaaa ggctcaagac gggtcactga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page