(data stored in ACNUC7421 zone)

EMBL: AP009493.PE408

AP009493.PE408       Location/Qualifiers
FT   CDS_pept        444161..444367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17237"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD6"
FT                   /protein_id="BAG17237.1"
FT                   /translation="MSDNTISITVELHGGPLDGQSTSVTLTEEDPWVALPNDGCTFPGG
FT                   RSIYAPDTNGRWVWQDDQPADIP"
     atgagcgaca acaccatctc gatcacagtc gaactccacg gcggaccact ggacgggcaa        60
     tccacctccg tgaccctcac ggaggaggac ccctgggtcg cgcttcccaa cgacggctgc       120
     acctttccgg gcggaagaag catctacgcg cccgacacca acggccgttg ggtgtggcag       180
     gacgaccagc cggccgatat cccgtga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page