(data stored in ACNUC7421 zone)

EMBL: AP009493.PE409

AP009493.PE409       Location/Qualifiers
FT   CDS_pept        444410..444664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17238"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQD7"
FT                   /protein_id="BAG17238.1"
FT                   /translation="MVDRIRVTGAWPTDLAAALPCREEEALLGALRQPDYPALASCPIC
FT                   DEPPESVVSCVEDPTADGCSVVLVDFKPCRHGIRVPTDA"
     gtggtggacc gcatccgcgt cacaggcgcg tggccgaccg acctcgcggc ggccttgccg        60
     tgcagggagg aggaggcgct cctcggagcc cttcggcaac ccgactaccc cgcgctcgcg       120
     tcgtgtccga tctgcgacga acccccggaa agcgtcgtgt cgtgcgtcga ggacccgacc       180
     gccgacgggt gctcggtggt cctcgtggac ttcaagccct gtcggcacgg catccgggtc       240
     cccacggacg cgtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page