(data stored in ACNUC7421 zone)

EMBL: AP009493.PE41

AP009493.PE41        Location/Qualifiers
FT   CDS_pept        complement(42629..44593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_41t"
FT                   /product="hypothetical protein with SsgA-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_41t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16870"
FT                   /db_xref="GOA:B1VLW9"
FT                   /db_xref="InterPro:IPR006776"
FT                   /db_xref="InterPro:IPR038658"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLW9"
FT                   /protein_id="BAG16870.1"
FT                   /translation="MSLHHDNAMPTADDDEFAALMAASSLRAPHVRALSDPIPNEARSR
FT                   LRETAEGPDTEQEPTACETQEATADAGDGDHSEEEPLATYRAGTWQPPALSRFLTEVYR
FT                   RLPWTIDRGPHGHHTSALHIRPLLAADLLETTRATDILVWLSREPDNDRHYLVTPTGAA
FT                   LAPTLLPCATDRSPTYSSARALLRLALPQWQKEYLLDARPGTGSPDFRLACTSLGPSAS
FT                   LAWVDSAIRFQTTRDECSAFRWVGDSEKHAPDADSRHRLHTLLSQAYESALVYYAAREP
FT                   GGNLRPFDQLVRTPGTADPTDTGAPAPALASLTAGRLTDLLQPVQPPHLEQLHPHPADR
FT                   WTGCRISTNPDRFPAGAWRPLLLGALADSPWAPRKTGQRLITGEAAPGSPTPQDATPMI
FT                   DVPLTPAHLLIAADSAVSLDQAHRHTIPEQVPTPPDLDAYTAQPGSLLLLPATTSTAAG
FT                   HGDNREAVHWTPRTERDFPSEGGSSGPSKFPDNDSRTPKLWSTKTEDGVDDLEQRMQLW
FT                   MRQHDTEDDRGDRILIELVYRTKDPHAVTAVFYTGTEEELEWTFARELLADGLHTSVGL
FT                   GDVIVWPGPEGPGDTQRIFIRLRPPGSTALLSLDRDDALEFLEATHPLLHNPRATARTA
FT                   VLPAWEQELRDLICPGTGE"
     atgagtcttc accacgacaa cgcgatgccg accgccgacg acgacgagtt cgccgccctg        60
     atggccgctt ccagcctgcg cgcccctcac gtgcgcgctc tcagcgaccc catccccaac       120
     gaggcgcgga gccgtctccg ggaaaccgct gaagggcccg acaccgagca ggagcccacg       180
     gcctgcgaga cccaggaagc caccgccgac gccggtgacg gcgaccactc cgaggaagag       240
     cccctcgcca cgtaccgggc cggcacctgg cagccgcccg ccctcagcag attcctcacc       300
     gaggtgtacc gccgtctccc ctggaccatc gaccgcggcc cccacgggca ccacacatcc       360
     gccctccaca tcaggccact gctggcggcc gacctcctgg agacgacgag ggcgaccgac       420
     atcctcgtat ggctgtctcg cgaacccgac aacgacaggc actacctcgt gacgcccacc       480
     ggggccgccc tcgctcccac gctcctgccg tgcgcgacgg accgcagccc gacgtactcc       540
     agcgcccgcg ctcttctgcg cctggccctg ccacagtggc agaaggagta cctgctcgac       600
     gcccgccccg gcactggcag tccggatttc cgactggcat gcacgtccct cgggccatcg       660
     gcctcactcg catgggtaga ttccgcaatc cgattccaga ccactcgcga tgaatgctcg       720
     gcattccggt gggtaggaga ctcggaaaag catgcccctg atgctgattc gaggcaccgg       780
     cttcacacgc tactgagcca ggcatatgaa agtgccctgg tctactacgc ggcccgcgaa       840
     cccggcggaa acctccggcc attcgaccag ctggtcagga cgcccggaac cgcagacccc       900
     acagataccg gcgcacctgc accggccctc gccagtctga ccgcagggcg cctgaccgac       960
     ctgcttcagc cagttcaacc accacacctg gaacagcttc acccacaccc ggccgacagg      1020
     tggacgggat gccgcatcag caccaacccg gacaggtttc ccgctggtgc ttggcgaccc      1080
     ctgctcctgg gcgccctcgc cgactccccg tgggcgccca gaaagacagg acagaggctg      1140
     atcacgggcg aagcagctcc gggcagcccg accccgcagg acgccacgcc catgatcgac      1200
     gtacccctca ctcctgccca ccttcttatt gccgccgact cggcggtgag cctggaccag      1260
     gcacaccgcc acaccatccc cgaacaagtg ccgaccccac ccgacctgga cgcctataca      1320
     gcccagcccg gcagccttct tctgctgccc gccaccacct cgacggcagc cggccacggg      1380
     gacaacagag aagccgtgca ctggactcca cgcactgaga gagatttccc ctcggaaggc      1440
     ggttccagcg gcccgtcaaa gttcccggac aacgacagca gaacgccgaa actgtggagc      1500
     acgaaaacag aagacggcgt cgacgacctg gaacagcgca tgcagctgtg gatgcgccag      1560
     cacgacacgg aagacgaccg cggcgaccgc atcctgattg aactcgtcta ccgcacaaaa      1620
     gaccctcacg cggtcacggc tgtcttctac acaggaacgg aagaggaact ggagtggacc      1680
     ttcgcacgcg aactcctggc cgacggactg cacaccagcg tcggcctcgg cgatgtcatc      1740
     gtctggcccg ggcctgaagg acccggcgac acacagcgca tcttcatccg gctgcgcccg      1800
     ccgggcagca ccgcgctgct gtcactggac cgcgacgacg ccctggagtt cctggaagcc      1860
     acccacccac tcctacataa cccccgcgcc acagcacgaa cagccgtcct ccccgcatgg      1920
     gaacaggaac tgcgagacct catctgccca ggcaccggcg aatag                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page