(data stored in ACNUC7421 zone)

EMBL: AP009493.PE419

AP009493.PE419       Location/Qualifiers
FT   CDS_pept        complement(454161..454874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17248"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQE7"
FT                   /protein_id="BAG17248.1"
FT                   /translation="MDVIELARALVLERHPDARAAFLGGSVLTRRRTARSDLDVVVLLD
FT                   GPPAPYRASLRYGDWPVELFVHTEESWHDFVTPEIVRRNSPLLWMCADGALLLDADGTG
FT                   ARISDTAERLAAAGPPPVTATALEDARYALTDLLDDFGACTDAGERLFVVADLVRRSAE
FT                   LALLTHGTWLGGGKWLARRLEPVAPDLAARLDEAARAALRGEQAALTSLVTEVLDAAGG
FT                   PVWEGYRRSGPRETA"
     atggacgtca tcgaactcgc ccgagctctc gttctggagc gccaccccga tgcccgcgcg        60
     gcgttcctcg gcggcagcgt cctgacgcgc cggcgcaccg cccggtccga cctggacgtc       120
     gtcgtgctgc tcgacggccc gcccgccccg taccgcgcga gcctgcggta cggggactgg       180
     ccggtggagc tgttcgtgca caccgaggag tcctggcacg acttcgtgac cccggagatc       240
     gtccggcgga actcgcccct gctgtggatg tgcgccgacg gcgcgctgct gctcgacgcc       300
     gacggaaccg gagcacggat ctcggatacg gccgaacgcc tcgccgccgc gggcccgccc       360
     ccggtcaccg cgacggcgct cgaagacgcc cggtacgcgc tgacggacct gctcgacgac       420
     ttcggcgcct gtacggatgc gggggagcgg ctgttcgtcg tggccgatct cgtccggcgg       480
     agcgccgagc tggcgctgct gacccacggg acctggctcg gcggcggaaa gtggctggcc       540
     cggcgcctcg aacccgtcgc accggacctg gccgcgcgcc tggacgaggc ggcgcgagcc       600
     gcgctgcgcg gcgagcaggc ggccctcacc tcgctggtca cggaggtcct cgacgcggcc       660
     ggcggcccgg tctgggaggg ataccgccgc agcggaccgc gtgagacggc ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page