(data stored in ACNUC7421 zone)

EMBL: AP009493.PE42

AP009493.PE42        Location/Qualifiers
FT   CDS_pept        complement(44590..45444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_42t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_42t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16871"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX0"
FT                   /protein_id="BAG16871.1"
FT                   /translation="MPDGDFRGRSAHDALPNLDETPADPAAELRGLERSLTGSTDEDTA
FT                   AHTRLREADASLVAFLRRQNFEGPHYRTFIAELMDYGWRTLSSWTTSGHIFERTARMGR
FT                   PVPPAMMPDTWAYEDRTQVVTDTVIKGSGLFREHGLVREKWTPEGGASLTTYFVGATIL
FT                   AFRPVYMRWHKDHHVGQSELNHRTADTDDILYAQRDIPDQRATDPAHAAVTHDDITRLR
FT                   TLLPDEQLREALGWMALGYTQAEAANRVGLTPKALERRLARARTRISASGLHTVQLEEG
FT                   GAR"
     gtgccggatg gagacttcag ggggcgctcc gcccacgacg cactcccaaa cctcgacgag        60
     acgcccgcag accccgcagc cgaactccgc ggcctcgaac gctccctcac cggaagcacg       120
     gacgaggaca ccgcagcgca tacccggctc cgggaagccg acgccagcct cgtcgcgttc       180
     ctgcgccggc agaacttcga aggcccgcac taccggacct tcatcgccga gctgatggac       240
     tacgggtggc gcacactgag cagctggacc accagcggcc acatcttcga acgcaccgcc       300
     cgcatgggcc gccccgtacc accggcgatg atgcccgaca cctgggccta cgaggaccgc       360
     acccaggtcg tcaccgacac cgtcatcaag ggcagcggcc tcttccgcga gcacggcctg       420
     gtccgcgaga agtggacccc cgaaggcggc gccagcctca cgacctactt cgtcggcgcg       480
     accatcctcg ccttccgccc cgtctatatg cgctggcaca aggaccacca cgtcggacag       540
     tctgaactca accaccgaac agccgacacc gacgacatcc tctacgccca gcgggacatc       600
     cccgaccagc gcgccaccga cccggcccac gccgccgtca cccacgacga catcacccgg       660
     ctgcgcacgc tgctgcccga cgagcaactg cgcgaggcac tcggctggat ggccctgggc       720
     tacacccagg ccgaggccgc caaccgcgtg ggcctgacac ccaaagcgct ggagaggcgc       780
     ctggcccgcg cccgcaccag gatttctgcc agcggactgc acaccgtcca gctggaggag       840
     gggggagcac gatga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page