(data stored in ACNUC7421 zone)

EMBL: AP009493.PE423

AP009493.PE423       Location/Qualifiers
FT   CDS_pept        457860..459131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17252"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF1"
FT                   /protein_id="BAG17252.1"
FT                   /translation="MRDVVFTRRSGWIPNVVRVDGELKLMLGAGADANHEPRTFMFPIE
FT                   ETHRAVIQEDLARHLLLWSAVLPLCDAAGTRGRLDEEAAVALLDPVLLSAPGDVDAIFR
FT                   RIPWARGRLVAHGADIDLLERGQVWAAMRGATETSDGKRAQKYHADRRRAERGTVLGPL
FT                   DSAILMYTGQYLHGSTVPKRKSDAVDPALLPEVLRVVATAEEACAGMWISRDPRRGKRA
FT                   TDKRDWTRMEAAVDAAVRRAHPELVDDAVRTVTFLMCSEAADRSRNTPMTPMEDDGRAA
FT                   GGPAASGDRAGKAVLSFTDDKGLEKKWRRDQGRSADAEFWEFVGDRSAADNEVFTIEDE
FT                   EMGEGIQLHFYADSAARITTVREGAGGTDPEYRVEYCLVDGVRGYRSLVTAFVRGGCAA
FT                   LERHGPWMADVADFERARRRRGAA"
     atgagagacg tcgttttcac gcgccggagc ggctggatac cgaacgtggt ccgcgtggac        60
     ggtgagttga aactgatgct cggtgcgggg gcggacgcca accacgagcc ccgcacgttc       120
     atgttcccga tcgaggagac ccatcgcgcg gtgatccagg aggacctggc cagacacctg       180
     ctgttgtggt ccgcggtcct gccgctgtgc gacgccgccg gaacccgggg ccggctcgac       240
     gaggaggcgg ccgtcgcgct cctggacccg gtcctcctct ccgcgcccgg ggacgtcgac       300
     gcgatcttcc ggcgcatccc ctgggcccgc ggtcggctcg tcgcccacgg ggccgacatc       360
     gatctgctcg aacgcggcca ggtctgggcg gcgatgcgcg gggcgaccga gacgtccgac       420
     gggaaacggg ctcagaagta ccacgcggac cgccgtcgcg ccgagcgcgg aacggtgctc       480
     ggcccgctcg actccgcgat tctgatgtac acgggccagt acctgcacgg ctcgaccgtc       540
     ccgaagcgga agtcggatgc cgtcgacccc gcgctgctgc ccgaggtcct gcgggtggtc       600
     gccacggcgg aagaggcgtg cgccgggatg tggatcagcc gcgatccacg gcggggcaag       660
     cgcgccacgg acaagcgcga ctggacccgg atggaggcgg cggtcgacgc ggccgtccgt       720
     cgtgcgcacc ctgagctcgt cgatgacgcg gtccgcaccg tgaccttcct gatgtgctcg       780
     gaggccgccg accgctccag gaacacgccc atgaccccca tggaggatga cgggagagcg       840
     gccggcggcc ccgccgcctc cggcgatcgt gcgggaaagg cggtcctgtc gttcaccgac       900
     gacaagggcc tggagaagaa gtggcgccgg gaccagggcc gttccgccga cgccgagttc       960
     tgggagttcg tcggcgaccg ctccgccgcc gacaacgaag tgttcaccat cgaggacgag      1020
     gagatgggcg aggggatcca gctccacttc tacgcggact cagcagcccg catcacgacg      1080
     gtccgcgagg gggcgggcgg gacggatccg gagtaccggg tcgaatactg cctggtggac      1140
     ggcgtccgcg gataccggag cctggtgacc gcgttcgtcc gcggcggctg cgccgcgctc      1200
     gaacggcacg gcccgtggat ggcggatgtc gccgacttcg agagggcgcg ccgtcggcgc      1260
     ggcgccgcgt ag                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page