(data stored in ACNUC7421 zone)

EMBL: AP009493.PE424

AP009493.PE424       Location/Qualifiers
FT   CDS_pept        459219..459659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17253"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF2"
FT                   /protein_id="BAG17253.1"
FT                   /translation="MSLLHDVAERDGWLCWVCDEPVDPDRSVNDEQGPSVDSRTADRKA
FT                   KVAERLAHRGCNSRKGAVKVSIAWPDRLYVVEPAPLIAVASRLERKGGRETVGRCPTRQ
FT                   DAQEAADWLVDRFSRLVPGLPVTAGVESGGGQFLVVLTAGRR"
     atgagccttc tccatgatgt ggccgagcgc gatggctggc tgtgctgggt gtgcgacgaa        60
     cccgtcgacc ccgacaggtc ggtcaacgat gagcagggtc ccagcgtcga cagcaggacc       120
     gccgaccgga aggccaaggt cgccgagcga ctcgcgcacc gcgggtgcaa ctcccgcaag       180
     ggcgcggtca aggtgtccat cgcctggccg gaccgtctgt acgtggtcga acccgcgccg       240
     ctgatcgccg tggcctcccg tctggagcgc aaggggggcc gcgagacggt gggccgctgt       300
     ccgaccaggc aggacgccca ggaagctgcg gattggctgg tggaccggtt ctcccgactg       360
     gtacccgggc tgccggtgac cgccggtgtc gagtcgggcg gcggccagtt cctcgtcgtc       420
     ctcaccgccg gccgccgctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page