(data stored in ACNUC7421 zone)

EMBL: AP009493.PE425

AP009493.PE425       Location/Qualifiers
FT   CDS_pept        complement(459750..460730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_425"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17254"
FT                   /db_xref="GOA:B1VQF3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF3"
FT                   /protein_id="BAG17254.1"
FT                   /translation="MPSPSGPVAAMERHQVAVYVGALAAGGLAGWAAPGLGPGLEHAIN
FT                   PVLAALLYVTFLQVPAAELARSVRSGRFLAATLVVNFVVVPLVVAAMFAFLPDDRAVRL
FT                   GVLLVLLAPCIDYVIVFSGLAGGSSERLLAATPLLLLAQMALLPVYLFLFMGPDLAEVV
FT                   DAGPFVEAFLVLIVIPLALAWLTQAWAARRRAGQRVADAMGTAMVPLMAAVLLTVVASQ
FT                   VPKLGDAGSLEDVGRVVPFYVVFLVVMAFAGFAVARLFRLDAPAGRAIVFTGATRNSLV
FT                   VLPLALALPDALAVAAVVVVAQTLVEVIGMVVYVRAVPRLLPLRS"
     ttgccgtcac cgtccggccc ggtcgccgcc atggaacgcc accaggtcgc cgtctacgtg        60
     ggagccctgg ccgccggcgg cctggcgggc tgggccgcgc ccggtctcgg gcccggcctg       120
     gagcacgcga tcaacccggt gctggccgcg ctgctctacg tgaccttcct gcaggtgccc       180
     gccgccgagc tggcacgttc ggtgcggtcg ggccgcttcc tcgccgcgac gctggtggtc       240
     aacttcgtcg tggtgccgtt ggtggtcgcc gcgatgttcg ccttcctccc ggacgaccgc       300
     gcggtgcgcc tcggcgtgct gctggtcctc ctggccccct gcatcgacta cgtgatcgtc       360
     ttcagcgggc tcgccggagg cagcagcgaa cgcctgctcg ccgccacccc gttgctgctc       420
     ctcgcccaga tggcactgct gccggtctac ctgttcctgt tcatgggccc ggacctggcc       480
     gaagtggtgg acgccgggcc gttcgtcgag gcgttcctcg tgctgatcgt catcccgctc       540
     gcgctggcgt ggctcaccca ggcgtgggcc gcgcgccgcc gggccgggca gagggtcgcc       600
     gacgcgatgg gcacggcgat ggtgccgttg atggccgccg tcctgctgac cgtggtcgcc       660
     tcccaggtgc cgaagctcgg cgacgccggc agcctggagg acgtgggccg cgtcgtgccc       720
     ttctacgtgg tcttcctcgt cgtgatggcg ttcgccgggt tcgccgtcgc ccgcctcttc       780
     cgcctggacg cccccgccgg gagggcgatc gtgttcacgg gcgcgacccg caactccctg       840
     gtcgtcctgc ccctcgccct ggcgctgccg gacgcgctgg ccgtcgccgc cgtggtcgtg       900
     gtcgcccaga ccctggtcga ggtgatcggc atggtcgtct acgtcagagc cgtgccccgg       960
     ctgctgccgc tccggagctg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page