(data stored in ACNUC7421 zone)

EMBL: AP009493.PE426

AP009493.PE426       Location/Qualifiers
FT   CDS_pept        460854..461435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17255"
FT                   /db_xref="GOA:B1VQF4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF4"
FT                   /protein_id="BAG17255.1"
FT                   /translation="MTATYTFDVFSSLDGFGSYNGEGDWGGYWGKQGPELLDRRLSLYG
FT                   EEQRMVFGAHTYRAFVRLLAPATQESGVGDAWVTRMRSLPATVVSTTLEDPLDWPDATV
FT                   AHGDAVDVVARLKEASDVPLRSHGSLSMNRALMAAGLVDRVQVTVFPVITGRTGTEPVL
FT                   RGAADFDLELIESRTLDGRTQELTYRPTPH"
     atgaccgcga cctacacgtt cgacgttttc tccagcctcg acggtttcgg ctcctacaac        60
     ggtgaaggcg actggggcgg ctactggggc aagcagggcc ccgagctgct cgaccgccgg       120
     ctgtccctgt acggcgagga gcagcggatg gtcttcggcg cccacaccta ccgtgcgttc       180
     gtgcggctgc tggccccggc cacgcaggag tccggcgtgg gtgacgcgtg ggtgacgcgg       240
     atgaggagcc tgccggcgac ggtggtctcg accacgctcg aagatcccct cgactggccg       300
     gacgcgaccg tcgcgcacgg cgacgccgtc gacgtcgtcg cccgcctcaa ggaggcgtcc       360
     gatgtgccct tgcgctccca cggcagtctg tcgatgaacc gggcgctgat ggccgccggg       420
     ctcgtcgacc gcgtccaggt gacggtcttc cccgtcatca ccggtcggac cggtacggaa       480
     ccggtcctgc gcggtgcggc cgacttcgac ctcgaactga tcgaaagccg gaccctcgac       540
     ggtcgcaccc aggagctcac ctaccggccc accccgcact ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page