(data stored in ACNUC7421 zone)

EMBL: AP009493.PE427

AP009493.PE427       Location/Qualifiers
FT   CDS_pept        complement(461464..462078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17256"
FT                   /db_xref="GOA:B1VQF5"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQF5"
FT                   /protein_id="BAG17256.1"
FT                   /translation="MKSFADPVRNYLSAVERESSALPADRRQELLADLAEHIEVTRTER
FT                   PEATIGEILAELGDPRTIAATALAEAGTETPGTRAGGGGDGPARRGKVHPLVPLLMLTL
FT                   SLPFTMIFNMGPDATFNPGPVFGFLFRVTGAVLLCTSVHWTAVQKTTGVLLTVVVPTTV
FT                   IASWNVISGWAAGETQALLGNLGVLALMVGTAVWLWRTRRA"
     atgaagtcct tcgccgaccc cgtacgcaac tacctctccg ccgtcgaacg ggagagctcc        60
     gcactcccgg ccgaccgccg ccaggagctc ctcgcggacc tcgccgagca catcgaggtg       120
     acccgcacgg agcgccccga ggccacgatc ggcgagatac tcgcggagtt gggggacccc       180
     cgcacgatcg cggcgacggc gctggccgag gcggggacgg agacccccgg cacacgggcc       240
     gggggcggcg gggacggacc cgcccggcgg ggcaaggtgc acccgctggt cccgctcctg       300
     atgctcacgc tctcgctgcc cttcacgatg atcttcaaca tgggccccga cgcgacgttc       360
     aaccccggcc cggtgttcgg cttcctgttc cgcgtcaccg gcgcggtgct cctctgcacc       420
     tccgtgcact ggacggctgt ccagaagacc accggcgtcc tgctcaccgt cgtcgtgccg       480
     accaccgtca tcgccagctg gaacgtgatc agcggctggg cggcgggcga gacccaggcg       540
     ctgctgggca acctcggagt cctcgccctg atggtcggca ccgccgtgtg gctctggcgg       600
     acgcgccgcg cctag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page