(data stored in ACNUC7421 zone)

EMBL: AP009493.PE43

AP009493.PE43        Location/Qualifiers
FT   CDS_pept        45639..45968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_43t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_43t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16872"
FT                   /db_xref="GOA:B1VLX1"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX1"
FT                   /protein_id="BAG16872.1"
FT                   /translation="MYTPPGPGPVGNPGGTAGHGTGQELPARTAATDHTRQQDPTGPQP
FT                   QQGPVGEGPLLGLRSAIILMLGILVATAAGVLTYSAQQDPATAALAAGGAFAGGVLFFQ
FT                   KIIAG"
     atgtacacac cccctggccc gggccccgtg ggcaacccgg gcggcaccgc cggccacggc        60
     accggacagg agcttcctgc ccgcaccgcg gcaacggacc acacccgcca gcaggatccg       120
     acgggccccc agccgcagca ggggcccgtc ggtgaggggc ccctgctggg cctgcgcagc       180
     gccatcatcc tgatgctcgg catcctcgtc gccaccgctg ccggtgtcct cacctacagc       240
     gctcagcagg atcccgcgac cgccgccctc gcagcaggcg gcgccttcgc cggcggcgtc       300
     ctcttcttcc agaaaatcat tgccggatag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page