(data stored in ACNUC7421 zone)

EMBL: AP009493.PE432

AP009493.PE432       Location/Qualifiers
FT   CDS_pept        465791..467014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17261"
FT                   /db_xref="GOA:B1VQG0"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG0"
FT                   /protein_id="BAG17261.1"
FT                   /translation="MANDIKDIAHAVDAAGVMRLFASPPRVLALGEPTHGVDAPLLLRN
FT                   ALFRQLVEREGYRTIAIESDSVAGLLVDSYVTTGSGTLDEAMGRGFSHGFGASAANREL
FT                   VDWMRAFNEGRPSGDRVRFAGFDGPLEMAYAASPREALTSLHRFLGDHVDPDLLPCTAG
FT                   TLDRLLGADDRWTDTAAMLDPSASFGRSAEAGRLRLLADDLGALLDAWTPHLIAVASRD
FT                   AFDRALMYARAASGLLRYHYWMADTSPSRLARLTGLRDQMMAGNLLALAERGPVLAHAH
FT                   NGHLQRDISSLLMGGRRLEWWSAGAVAEARLGEGYGFLATAFGTLRHQGVGVPPPETLE
FT                   GALYALPEESCLVDAAELAAVLGAPGPVPRTSPYFGYAPLDPAHLARVDGVVFMKDVPE
FT                   DRRTPPTP"
     atggccaacg acatcaagga catcgcccac gccgtcgacg cggccggcgt catgaggctg        60
     ttcgcctccc cgccccgagt gctcgctctg ggcgagccca cccacggggt ggacgcccct       120
     ctcctgctgc gcaacgccct cttccggcag ctcgtcgaac gggaggggta ccgcaccatc       180
     gccatcgaga gcgacagtgt ggcgggactg ctggtggact cctacgtgac cacgggctcg       240
     ggcaccctcg acgaggcgat ggggcggggg ttcagccatg gcttcggcgc atcggccgcc       300
     aaccgtgaac tcgtcgactg gatgcgcgcg ttcaacgaag ggcggccctc cggtgaccgg       360
     gtccgcttcg ccggcttcga cggcccgctg gagatggcgt acgccgcgag cccgcgcgag       420
     gccctcacct cgctgcaccg ctttctcggc gaccacgtgg acccggatct gctcccctgc       480
     accgccggga cgctcgaccg cctcctcggc gccgacgacc ggtggaccga cacggcggcg       540
     atgctggacc cgtccgcgtc cttcgggcgg tcggccgagg ccgggcggct tcgcctgctc       600
     gccgacgacc tgggcgcgct gctcgacgcg tggacgccgc acctgatcgc ggtggcctcg       660
     cgggacgcct tcgaccgggc gctgatgtac gcccgggccg catcgggact gctgcggtac       720
     cactactgga tggcggacac ctcaccgagc cgcctggcac gcctcaccgg cctgcgggac       780
     cagatgatgg ccggcaacct cctcgcgctc gccgagcggg ggcccgtcct ggcgcacgcc       840
     cacaacggcc atctccagcg tgacatcagt tccctgctga tgggcggccg acggctggag       900
     tggtggagcg cgggcgcggt cgccgaggcc cgcctgggcg agggctacgg cttcctggcc       960
     accgccttcg gcaccctgag gcaccagggg gtcggcgttc cgccgccgga gaccctcgaa      1020
     ggggccctgt acgccctccc ggaggagtcg tgcctggtgg acgccgccga actggccgcc      1080
     gtcctcggcg ccccgggccc cgtcccgcgc acgtccccgt acttcggtta cgcccccctc      1140
     gacccggcgc acctggcccg cgtcgacgga gtcgtgttca tgaaggacgt cccggaggac      1200
     cggcggacgc cgccgacgcc ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page