(data stored in ACNUC7421 zone)

EMBL: AP009493.PE433

AP009493.PE433       Location/Qualifiers
FT   CDS_pept        467142..468041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17262"
FT                   /db_xref="GOA:B1VQG1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG1"
FT                   /protein_id="BAG17262.1"
FT                   /translation="MTSEISGTGRTFGRVGVWSGALHTSRVDDAGGKAIAEALAELEEL
FT                   GYGTVWIGGSPTPEDAAAVVAATRSVTVATGILSIWNHTAEETAAAVAAIDPAARGRFV
FT                   LGLGVSHGPMVPQYAKPYSAMVSYLDALDAAEPSVGPGHRVLAALGSRMLKLAAGRSLG
FT                   AHPYLVTTEHTAEAREALGPDALLAPELTVVLDTDLDRARATARTMLGMYLRLPNYTDN
FT                   LLRLGFTEGDFDGGGSARLLDALFALGDAGQVRSRTREYLDAGADHVALQVLTADEGGS
FT                   GLPRAAWRELAEAFGDEL"
     atgacttctg agatttccgg aacgggcagg acattcgggc gcgtgggtgt ctggagcggc        60
     gcgctgcaca cctcgcgggt ggacgacgcg ggcgggaagg cgatcgcgga ggcgctcgcc       120
     gaactcgaag aactggggta cggcaccgtc tggatcgggg gcagtccgac gcccgaggac       180
     gcggcggccg tcgtggccgc cacccggtcg gtcacggtgg ccaccggcat cctgtccatc       240
     tggaaccaca cggccgagga gaccgcggca gcggtcgccg cgatcgatcc ggcggcgcgc       300
     ggtcgcttcg tcctcggtct cggcgtcagc cacggcccga tggtgccgca gtacgcgaag       360
     ccgtacagcg cgatggtgtc gtatctcgac gcgctcgacg ccgccgaacc gtccgtgggc       420
     cccggccacc gggtcctggc ggctctcggt tcgaggatgc tgaagctcgc ggccggccgt       480
     tcgctggggg cgcaccccta tctcgtcacc accgagcaca ccgccgaggc ccgtgaggcg       540
     ctcggccccg acgcgctgct cgccccggag ctgacggtgg tgctggacac cgacctcgac       600
     cgggcccgcg cgaccgcgcg gacgatgctg gggatgtatc tgcggctgcc caactacacc       660
     gacaacctgc tgcgcctggg gttcacggag ggcgacttcg acggcggcgg cagcgcccgt       720
     ctgctcgacg ccctcttcgc gctgggcgac gccgggcagg tgaggagccg gacccgggag       780
     tacctcgacg ccggcgccga ccatgtcgcg ttgcaggtgc tcaccgccga cgagggcggc       840
     tcgggcctgc cgcgggccgc gtggcgtgag ctggccgagg ccttcggcga cgagctctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page