(data stored in ACNUC7421 zone)

EMBL: AP009493.PE434

AP009493.PE434       Location/Qualifiers
FT   CDS_pept        468173..469261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_434"
FT                   /product="hypothetical protein containing a Rieske [2Fe-2S]
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17263"
FT                   /db_xref="GOA:B1VQG2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG2"
FT                   /protein_id="BAG17263.1"
FT                   /translation="MVREYGRTISEGPTPADAAGAPALPYPSGWSALAFSHELRPGTVL
FT                   TRPLAGRDVVLYRTATGVLRAVRPYCPHLGAHLGLAKVEGEDLTCPFHFFSFGPDGSCV
FT                   RTGYGTPPPRSPLTQLPVQEANGGVFVWRHHDGRDPDWSVPRWHEIGHRPARTAAWELA
FT                   GNVQEVIENSVDLGHFATLHGWAKAEIDGPVAYDDAKFHVAMRAHESAPLMGDFTVDVK
FT                   VDGYGLGCLHADVHTPRFGLRMCTMVMPTAIGPNRMQFRQLNRISFDEPGRLPPGLARL
FT                   VSRTAARLLDRPVFRSSCEFTAADFPIWHHKQYQQPPRLASGDGPIGPFRRWAKRFYPE
FT                   APGRTAVTRPHRGEGEDSAVLS"
     gtggtacgtg agtacgggcg caccatcagt gagggtccga caccggcaga cgcggcggga        60
     gcaccggccc tgccctatcc gagcggttgg tccgccctgg ccttctcgca cgagctgcgg       120
     ccgggcaccg tgctcacccg gccgctcgcg gggcgcgacg tcgtcctgta ccgcaccgcc       180
     acgggagtgc tgcgggccgt ccgcccgtac tgcccgcacc tgggggccca tctcggtctg       240
     gcgaaggtcg agggggagga cctcacctgc cccttccact tcttctcgtt cggccccgac       300
     ggcagttgcg tgcgcacggg gtacggcacg ccgccgcccc ggtccccgct gacccaactg       360
     cccgtccagg aggcgaacgg gggcgtcttc gtctggcggc accacgacgg ccgggatccg       420
     gactggtccg tcccgcggtg gcacgagatc gggcacaggc ccgcgcgcac ggccgcgtgg       480
     gagctggcgg gcaacgtcca ggaggtcatc gagaactcgg tcgacctcgg gcacttcgcc       540
     accctgcacg gctgggccaa ggccgagatc gacgggccgg tggcgtacga cgacgcgaag       600
     ttccacgtgg ccatgcgggc ccacgagtcg gcgccgctca tgggcgactt caccgtcgac       660
     gtgaaggtcg acggctacgg actcggctgc ctgcacgccg acgtccacac gccccgcttc       720
     gggctgcgga tgtgcaccat ggtgatgccg acggccatcg gccccaaccg gatgcagttc       780
     cgccagctga accgcatctc cttcgacgag ccgggccggc tgccgcccgg gctcgcccgg       840
     ctcgtcagcc gcaccgccgc gcggctgctg gaccgccccg tcttccggtc cagttgtgag       900
     ttcaccgccg ccgacttccc gatctggcac cacaagcagt accagcagcc gccccggctg       960
     gcctccggtg acggaccgat cggcccgttc cggcgctggg ccaagcggtt ctatccggag      1020
     gcgccgggca ggaccgcggt gacccggccc caccgcggcg agggcgagga cagcgccgtc      1080
     ctctcctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page