(data stored in ACNUC7421 zone)

EMBL: AP009493.PE436

AP009493.PE436       Location/Qualifiers
FT   CDS_pept        470545..471912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_436"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17265"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG4"
FT                   /protein_id="BAG17265.1"
FT                   /translation="MPHPGRRSRPRVRGRACAVTAALALLATGCAGAGGTSFGGGDALN
FT                   VLMVNNPQMVELQKLTAKHFTKETGVKVHFTVLPENDVRDKISQDFSNQAGQYDVATIS
FT                   NFELPFFAKNGWLHPLDDYAKADTAFDQEDILAPLRESLTAEDGKLYAQPFYGESSFLM
FT                   YRKDVFEERGLTMPDRPTWQQVAKLAERADGAERGMKGICLRGLPGWGEVIAPLTTVVN
FT                   TMGGTWFTEDWEPRLTAPEFKKATKFYVDLVREHGELGAPQSGYAECLNNMTQGKTAMW
FT                   YDATAGAGSLEAKGSPVKGKIGYVPAPVERTDSSGWLYTWAWGLQKASKKADDAWKFVS
FT                   WASGKEYEELVGATSGWSNVPAGKRASTYANPDYRAEAGAFADVTERAISEADPRNPGV
FT                   QPRPTAGIQFVGVPEFTDLGTRVAQEISAAIAGRQSVDAALDASQKLAEKVAEEYR"
     atgccccatc caggacgccg cagccgacca cgtgtacgcg gtcgggcctg tgccgtgacc        60
     gccgcactgg ccctgctcgc caccggctgt gccggggcgg gcgggacctc cttcgggggc       120
     ggcgacgccc tgaacgtgct gatggtgaac aacccgcaga tggtcgaact gcagaagctc       180
     accgcgaagc acttcacgaa ggagaccggc gtcaaggtcc acttcacggt gctgcccgag       240
     aacgacgtgc gcgacaagat cagccaggac ttctccaacc aggccggtca gtacgacgtc       300
     gccaccatca gcaacttcga gctgcccttc ttcgcgaaga acggctggct gcaccctctc       360
     gacgactacg cgaaggccga caccgccttc gaccaggagg acatcctggc gccgctgcgg       420
     gaatcgctga ccgccgagga cggcaagctc tacgcccagc ccttctacgg cgagtcgtcc       480
     ttcctgatgt accgcaagga cgtcttcgag gagcggggcc tgacgatgcc cgacaggccg       540
     acctggcagc aggtggcgaa gctcgccgag cgggcggacg gggcggagcg cgggatgaag       600
     ggcatctgcc tgcgcgggct gccgggctgg ggcgaggtca tcgccccgct caccacggtc       660
     gtcaacacga tgggcggcac ctggttcacc gaggactggg agccgcgcct gaccgcgccg       720
     gagttcaaga aggcaacgaa gttctacgtc gatctggtgc gcgagcacgg agagctgggc       780
     gccccgcagt ccggctacgc cgagtgcctc aacaacatga cccagggaaa gaccgccatg       840
     tggtacgacg cgacggcggg cgccgggtcc ctggaggcga agggctcccc ggtgaagggg       900
     aagatcgggt acgtccccgc ccccgtcgag cggaccgaca gttcgggctg gctctacacc       960
     tgggcctggg ggctgcagaa ggcgtccaag aaggcggacg acgcctggaa gttcgtctcc      1020
     tgggcctccg gcaaggagta cgaggagctc gtcggcgcca ccagcggctg gtccaacgtc      1080
     ccggcgggca aacgggcctc cacctacgcc aaccccgact accgtgcgga ggccggcgcg      1140
     ttcgcggacg tcaccgagcg ggccatctcc gaggccgacc cgaggaatcc gggtgtccag      1200
     ccccgcccga cggcgggcat ccagttcgtc ggcgtgccgg agttcaccga tctgggcacc      1260
     cgggtggcgc aggagatcag cgccgccatc gcgggccgtc agtcggtcga cgccgcgctc      1320
     gacgcctcgc agaagctggc cgagaaggtc gcggaggagt accgatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page