(data stored in ACNUC7421 zone)

EMBL: AP009493.PE44

AP009493.PE44        Location/Qualifiers
FT   CDS_pept        complement(46172..46705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_44t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_44t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16873"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX2"
FT                   /protein_id="BAG16873.1"
FT                   /translation="MSADARNVWGPLTEGLNIPRDLDLGDRARALNQLGVTPDAHRTLV
FT                   RTVNETLPQQEAGFLVSSRQWPVLAHRMHRMTQQNLPLAEHLARITPDTAPWRTGPLSN
FT                   IAARLLLAAHHALTTPLDQPLPTGPRVSTTAARSRSTTAVPDRTTPKQPAPVRPAVPAH
FT                   RQQTAPAARHARGR"
     gtgagcgccg acgcgaggaa cgtctggggc ccgctgaccg aaggcctgaa catcccccgc        60
     gacctcgacc tcggcgaccg ggcccgcgcc cttaaccagc tcggcgtcac ccccgacgct       120
     caccgcaccc tggtgaggac ggtcaacgag accctgcccc agcaggaggc cgggttcctg       180
     gtgagctccc gtcagtggcc cgtcctcgcc caccgcatgc accgcatgac ccagcagaac       240
     cttcccctcg ccgaacacct cgcccgcatc acccccgaca ccgccccctg gcgcaccggc       300
     ccgctctcca acatcgccgc ccgtctgctc ctggccgccc accacgcact caccacaccc       360
     ctcgaccagc cactgcccac cggcccccgc gtctccacca ccgcagcccg ctcccgctcc       420
     accaccgcgg tcccggacag gaccactccg aagcagcccg cccccgtccg acccgccgtg       480
     cccgcccacc gccagcagac cgcgcccgca gcacggcacg cacgcggcag gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page