(data stored in ACNUC7421 zone)

EMBL: AP009493.PE440

AP009493.PE440       Location/Qualifiers
FT   CDS_pept        474732..475667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_440"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17269"
FT                   /db_xref="GOA:B1VQG8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG8"
FT                   /protein_id="BAG17269.1"
FT                   /translation="MTDPGPSRAADPGAVLVLGEALVDLVPADGDTGVRAAQPGGGPAN
FT                   VAVGLARLGGRPSFVGGFGDDAFGARVASWLSGAGVDLSLSRRSSLPTALAVADPGDHG
FT                   NTYRFHLGDTATFELPDRAAEAGRFGAVYAGGLAAVVAPAADAVAATARAAAATGLLVV
FT                   DPNVREDRTLDPVASLGRLRELCSLARVVKASDEDLARLWPDASPEASCRALAAEGRLV
FT                   VMTRGPKGATAYVHDAPAVSVPAVPVRVVNTIGAGDAFMAGMLTWLGAEAGWDPALSAG
FT                   RTQAMLEYAAATAASVCARAGTEPTAPPGV"
     gtgacggatc cggggccgtc gcgtgccgcg gatcccgggg ccgtcctcgt gctcggtgag        60
     gcgctggtgg atctggttcc ggccgacggc gacaccgggg tccgggcggc ccagccgggt       120
     ggcgggccgg ccaacgtcgc ggtgggcctg gcccgtctcg gcgggcggcc gtccttcgtg       180
     ggcgggttcg gcgacgacgc cttcggggcc cgcgtcgcgt cctggctgag cggtgcgggc       240
     gtcgacctct cactgagccg ccggtcgtcg ctgccgacgg cgctcgcggt ggccgacccg       300
     ggcgaccacg ggaacacgta ccgcttccac ctcggtgaca cggcgacctt cgagctgccc       360
     gaccgggcgg cggaggccgg gcggttcggc gcggtgtacg cgggcgggct cgccgcggtc       420
     gtggctccgg cggccgatgc cgtggccgcc accgcgcggg cggccgccgc cacggggctc       480
     ctcgtggtgg accccaatgt gcgcgaggac cgcaccctgg accccgtggc gagcctcggc       540
     cggctccgcg agctgtgctc gctcgcccgg gtcgtgaagg cgagcgacga ggacctggcg       600
     cgcctgtggc cggacgcgtc cccggaagcc agctgccggg cgctcgccgc ggagggacgg       660
     ctggtcgtga tgacccgggg gccgaagggc gccaccgcgt acgtccacga cgctcccgcc       720
     gtctcggtcc cggccgtgcc ggtgcgggtg gtgaacacga tcggcgcggg cgacgcgttc       780
     atggcgggga tgctgacctg gctgggggcg gaggcgggct gggatccggc gctgtccgcc       840
     gggcggacgc aggcgatgct ggagtacgcg gcggcgacgg ccgcgtcggt ctgcgcccgg       900
     gcgggaacgg aacccacggc cccgcccggg gtgtga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page