(data stored in ACNUC7421 zone)

EMBL: AP009493.PE441

AP009493.PE441       Location/Qualifiers
FT   CDS_pept        complement(476025..476513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17270"
FT                   /db_xref="GOA:B1VQG9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQG9"
FT                   /protein_id="BAG17270.1"
FT                   /translation="MEGGPQGRWTESQENRSTSPMSLPSYPDSPYPGQPAADHDPYGGQ
FT                   APARTNGFAVAALVLGLIACLFFWTVVGGLLLGLLAVVFGIIAALRTRQGRAPRRVMAI
FT                   VGAAFGALGLIGSVIVLVVAVSVFDSQEFQNLEDCMNRANGQAAEDRCAEDFVDELTN"
     atggagggcg gcccacaggg caggtggacg gaaagccagg agaacaggag cacctccccg        60
     atgtctcttc cctcgtaccc ggactccccg tacccggggc agcccgccgc cgaccacgac       120
     ccctacggcg gccaggcgcc cgcccggacg aacgggttcg cggtcgccgc gctcgtgctc       180
     ggcctgatcg cctgcctgtt cttctggacc gtggtgggcg ggctgctgct cggcctgctc       240
     gccgtcgtct tcgggatcat cgccgcgctc cgtacccgcc agggccgcgc gccgcgccgg       300
     gtgatggcga tagtcggcgc cgcgttcggg gcgctcgggc tcatcggatc cgtgatcgtc       360
     ctcgtggtgg ccgtctccgt gttcgactcc caggagttcc agaacctcga ggactgcatg       420
     aaccgggcca acggccaggc ggccgaggac cggtgcgcgg aggacttcgt cgacgagctg       480
     accaactga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page