(data stored in ACNUC7421 zone)

EMBL: AP009493.PE442

AP009493.PE442       Location/Qualifiers
FT   CDS_pept        complement(476540..477097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17271"
FT                   /db_xref="GOA:B1VQH0"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VQH0"
FT                   /protein_id="BAG17271.1"
FT                   /translation="MHHPARELPFPDALRPGARPAPHPLLAPVTGYLGTWRGTGSGGYP
FT                   TLDADFSYAQEVTFSHDGRPFLAYEARAWLLDADGQPLRPSARETGWWRLQPDGRVEAL
FT                   ITQPTGIAEISVGHARDGAVDLATERVALAPTAKEVDATRRRYTLTDPDTLTFVHDLAA
FT                   VGRPLQHHLSARLRREAPGQGI"
     atgcaccacc ccgctcgcga actccccttc ccggacgccc tccgccccgg agcccgtccg        60
     gcaccgcatc cgctgctcgc cccggtgacc ggctacctcg gcacctggcg gggcacgggc       120
     agcggcggat acccgacgct ggacgcggac ttcagctacg cgcaggaggt cacgttcagc       180
     cacgacgggc ggcccttcct cgcgtacgag gcccgcgcct ggctgctcga cgcggacgga       240
     cagcccctgc ggccgtccgc ccgcgagacg gggtggtggc gcctccagcc ggacgggcgg       300
     gtggaggccc tgatcaccca gcccaccggc atcgcggaga tctcggtcgg ccacgcccgc       360
     gacggcgccg tcgacctcgc cacggagcgg gtggccctcg ccccgacggc caaggaggtc       420
     gacgccaccc gccgccgcta caccctcacg gatccggaca cgctcacctt cgtccacgac       480
     ctcgcggccg tcggccggcc gctccagcac cacctgtcgg cacggctccg cagggaggcc       540
     cctggccagg gcatttag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page