(data stored in ACNUC7421 zone)

EMBL: AP009493.PE446

AP009493.PE446       Location/Qualifiers
FT   CDS_pept        complement(481572..482369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_446"
FT                   /product="putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17275"
FT                   /db_xref="GOA:B1VQH4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQH4"
FT                   /protein_id="BAG17275.1"
FT                   /translation="MSTVATETHRNRRPGRMHVTTVRRARRITPGMVRLTLGGDDLSEF
FT                   VSNGSDQHVALYFYEPHVELPRPFTTEAARALLPTAKPRLRRYTIRDHRPELHEVEMDF
FT                   VLHGPGQLASGWAERVRPGDEVIWFGPSPAYPVAPVTDWTLLLGDETALPAIGAILEEL
FT                   PPGHRVLAAVEVADPAEEQPLPTPADATVTWLHRDGRDHGELLRRHATALHLPEGRGRV
FT                   WGGAERGVMRDLRHHFVHVRGLGRADTHLTAYWTQGETQDSEV"
     atgagcacgg tcgcgaccga aactcaccga aaccgcaggc cagggcgcat gcatgtgacc        60
     accgtgcgca gagcgcgacg catcaccccg ggcatggtgc ggctcactct gggaggtgac       120
     gacctgtcag agttcgtcag caatgggagc gatcagcatg tcgccctcta cttctacgag       180
     ccccacgtcg aactgccgcg ccccttcacc accgaggccg cccgggccct gctgcccacc       240
     gccaaaccac gcctgcgccg ctacaccatc cgtgaccacc gtcccgaact ccacgaagtc       300
     gaaatggact tcgtgctcca cggacccgga cagctcgcct ccggctgggc cgagcgcgtc       360
     cggccgggcg acgaggtgat ctggttcggc ccgagccccg cctacccggt ggcccccgtc       420
     accgactgga ccctcctcct gggcgacgag acggccctgc ccgccatcgg cgcgatcctc       480
     gaagaactcc ccccgggcca ccgcgtcctg gccgccgtcg aggtcgccga cccggccgag       540
     gaacagcccc tccccacccc ggccgacgcc accgtcacct ggctccaccg cgacgggcgc       600
     gaccacggcg aactcctgcg ccgacacgcc accgcactcc acctcccgga aggccggggg       660
     cgcgtgtggg gcggcgcgga acgcggtgtc atgcgggacc tgcgccacca cttcgtccac       720
     gtccgcggac tcggccgcgc ggacacccat ctgaccgcct actggacgca gggcgaaacc       780
     caggacagcg aggtctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page