(data stored in ACNUC7421 zone)

EMBL: AP009493.PE447

AP009493.PE447       Location/Qualifiers
FT   CDS_pept        482504..483499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_447"
FT                   /product="putative ABC-type Fe3+-siderophore transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17276"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQH5"
FT                   /protein_id="BAG17276.1"
FT                   /translation="MNMARSRILSGPVERRRVLGGLTGAAAALGLTACGVSESDDKASN
FT                   GGSKESSGAGTRSLETDNGTVKVPQKPERVVVLENYDALMLLDLGLVPVGVPDGAANPQ
FT                   LLPEDVYEQLKDVDTIGASGTPNSQAIAALKPDLIIDQFYKEKSAPLRTIAPVAFYDWH
FT                   TSGAFWNEQIAKLAKAVNRESRLAEKKQEYERRLTEVRTAYRKQIETTTWAPLSGGPNG
FT                   KFFLGTPLVTVMRDVGLRIGAGLPEKEAGFVPKSYEEMDVLKDCDALIYSVQADGRPTP
FT                   TTQQLLDHKLWKGVPAVKAGRAFPSRHFVMANYSFAIATVDEIEGMLKKM"
     gtgaacatgg cacgttcacg tatcctgtcc ggtccggtgg agcgcaggcg cgtcctcggc        60
     ggactcacgg gtgccgcggc ggcgttgggg ctgacggcct gtggcgtgag cgagtccgac       120
     gacaaggctt ctaacggcgg ctccaaggag tcctccggcg cggggacgcg cagcctggag       180
     acggacaacg ggaccgtgaa ggtcccgcaa aagcccgagc gggtggtggt tctggagaac       240
     tacgacgccc tgatgctcct ggatctcgga ctggtcccgg tcggcgtccc cgacggcgcg       300
     gccaaccctc agctgctgcc cgaggatgtg tacgagcagc tcaaggacgt cgacacgatc       360
     ggcgcctcgg gcacgcccaa ctcccaggcc atcgcggccc tcaagccgga tctgatcatc       420
     gatcagttct acaaggagaa gtccgccccg ctcaggacca tcgcgccggt ggccttctac       480
     gactggcaca ccagcggggc gttctggaac gagcagatcg ccaaactggc gaaggcggtc       540
     aaccgcgaga gccggctggc cgagaagaag caggagtacg agcgccggct cacggaggtg       600
     cggaccgcct accgcaagca gatcgagacg accacgtggg ccccgctgag cggcggcccc       660
     aacggcaagt tcttcctggg gacgccgctg gtcaccgtga tgcgcgatgt cggactgcgg       720
     atcggggccg ggctgcccga gaaggaggcc gggttcgtgc ccaagagcta cgaggagatg       780
     gacgtcctca aggactgcga cgccctgatc tactcggtgc aggcagacgg caggcccacg       840
     cccacgaccc agcagttgct ggaccacaaa ctgtggaagg gcgttcccgc cgtcaaggcc       900
     gggcgggcgt tcccctcgcg gcacttcgtg atggccaact acagcttcgc gatcgccacc       960
     gtcgacgaga tcgagggcat gctcaagaag atgtag                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page