(data stored in ACNUC7421 zone)

EMBL: AP009493.PE45

AP009493.PE45        Location/Qualifiers
FT   CDS_pept        48328..50304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_45t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_45t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16874"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VLX3"
FT                   /protein_id="BAG16874.1"
FT                   /translation="MNPPTVSARVRGRAAELERIGTLVRGRGGGMVVVCGAGGLGKTTL
FT                   AAEASARARAEGRVVVWIRWRDGAAQLGQDLAQAAHILGLPESRLEDARTGRVSLVDAV
FT                   WEHLATVKGWLIVVDNVDTPSRVGPGSGLPAAYRGWLRPHGGGVLLVTSRDTTRQTWGP
FT                   DADLIHLQPLADDAAGTVLLDAAAHAGTETEAEALAVRLGGLPLGLNAAGTYLSVPTSR
FT                   HRTFAAYQHALEAEFADLLGAEHPGAAADPDAARRVVRHTWDLSLDQLHQDCYALARPV
FT                   LQLLALLEPAPVPRSLVTPGLVTDATGLPATAATVDAALAGLHQYGLLHTPGDANPGDG
FT                   GPPVNQVRLHRLVRDVTAHTLTRPEPTDTWVAAIDEHLARAVDATTSMPGRTGWPTARL
FT                   LAVHLRSHLDRRAQRDFTTAVGTLDDLADALNNAGAASEELLLRRHLLDAETRLLGADH
FT                   PDTLATRNNLASTLNDLGEHQQAAVLHHQTLTARERILGPDHPNTLSSRNNYANVLNRL
FT                   GDHRQAAGLHRQDLTDRERVLGSHHPDTLGSRNNLATALNRLGDHRQAADLHRRNLTDS
FT                   ERILGPDHPNTLSSRNNLANALNALGEHQQAADLHHQTLTARERILGPNHPDTLTTRNN
FT                   LATAQARLAEVGRRRWWQLPRRR"
     atgaacccgc ctacggtctc ggcacgggta cgggggcgtg cggcggagct ggagcggatc        60
     ggcaccctgg tccgggggcg tggcgggggc atggtggtgg tgtgcggggc cggagggctg       120
     gggaagacca cgctcgccgc agaggcctcg gcccgggccc gggccgaggg tcgggtggtg       180
     gtgtggatcc gttggcgcga cggtgccgcc cagctcgggc aggacctggc ccaggccgcc       240
     catatcctcg gccttcccga gtcccggctg gaggatgccc ggacgggaag ggtgtcgctc       300
     gtcgacgccg tctgggaaca cctggccacc gtcaaggggt ggctgatcgt cgtcgacaac       360
     gtcgacaccc cctcccgcgt cgggccgggg tcggggctcc cggccgccta ccggggctgg       420
     ctgcgcccgc acggaggcgg agtcctgctc gtcacgagcc gcgacaccac ccggcagacc       480
     tgggggccgg acgccgacct gatccacctc cagcccctcg ccgacgacgc ggccggcacg       540
     gtcctcctgg acgccgcagc gcacgccgga accgaaaccg aggccgaggc cctggctgtc       600
     cggctcggcg ggctcccgct cgggctgaac gccgcgggca cctacctgtc ggtccccacc       660
     agccggcacc ggaccttcgc cgcctaccag cacgctctcg aagccgagtt cgccgacctc       720
     ctcggcgccg aacaccccgg agcagcggct gacccggacg ccgcgcgccg ggtcgtccgg       780
     cacacctggg acctctccct cgaccagctc caccaggact gctacgccct cgcccgcccc       840
     gtcctccagc tcctcgccct cctcgaaccc gccccggtcc cccgcagcct ggtgacgccc       900
     gggctcgtca ccgacgccac cgggctgccc gcgaccgcgg ccacggtgga cgccgcgctc       960
     gccgggctcc accagtacgg gctcctccac acccccgggg acgccaaccc cggggacggt      1020
     ggtccgccgg tgaaccaagt ccggctccac cgcctggtcc gggacgtcac cgcccacacc      1080
     ctcacccgtc cggaacccac ggacacctgg gtcgcggcga tcgacgagca cctcgcccgg      1140
     gctgtggacg cgacgacgag catgcccggc cggaccggat ggcccaccgc acgcctcctc      1200
     gccgtccacc tccgatccca tctcgaccgc cgcgcgcaac gcgatttcac cactgccgtc      1260
     ggcacgctgg acgatctcgc cgacgcactc aacaacgcag gagcagcctc cgaggaactc      1320
     ctcctgcgcc ggcacctcct ggacgccgag acccgcctcc tgggcgccga ccaccccgac      1380
     actctcgcca cccgcaacaa cctcgccagc acgctgaacg acctcggaga acaccagcag      1440
     gccgccgtcc tccaccacca gaccctcacc gcccgcgaac gcatcctcgg ccccgaccac      1500
     cccaacaccc tcagcagccg caacaactac gccaacgtgc tgaacaggct gggtgatcac      1560
     cgacaagcag ccggcctcca ccgccaggac ctcaccgacc gtgaacgcgt cctcggttcc      1620
     caccaccccg acaccctcgg cagccgcaac aacctcgcca ccgcgctgaa caggctgggt      1680
     gatcaccgac aagcagccga ccttcaccgc cggaacctca ccgacagcga acgcatcctc      1740
     ggccccgacc accccaacac cctcagcagc cgcaacaacc tggcgaacgc gctgaacgct      1800
     ctcggagaac accaacaagc agccgacctc caccaccaga ccctcaccgc ccgcgaacgc      1860
     atcctcggcc ccaaccaccc cgacacgctc accacccgca acaacctcgc cactgcacag      1920
     gcccggctgg ccgaggtcgg gcgccgacga tggtggcaac tgccccgccg aaggtga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page