(data stored in ACNUC7421 zone)

EMBL: AP009493.PE452

AP009493.PE452       Location/Qualifiers
FT   CDS_pept        complement(534276..534494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_452"
FT                   /product="putative MbtH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17281"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI0"
FT                   /protein_id="BAG17281.1"
FT                   /translation="MTNPFEDEDGTYLVLVNDEGQHSLWPAFAEVPAGWTVAHPEDTRQ
FT                   ACLDYVERNWTDLRPKSLIESMAADPT"
     gtgaccaatc cgttcgagga cgaggacggc acctacctgg tgctcgtcaa cgacgaagga        60
     cagcactcct tgtggcccgc gttcgccgag gtgcccgccg gatggaccgt ggcccacccg       120
     gaggacaccc gccaggcctg cctggactac gtcgagcgga actggaccga tctgcggccc       180
     aagagcctca tagagagcat ggcggccgat cccacatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page