(data stored in ACNUC7421 zone)

EMBL: AP009493.PE453

AP009493.PE453       Location/Qualifiers
FT   CDS_pept        complement(534659..535807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_453"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17282"
FT                   /db_xref="GOA:B1VQI1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI1"
FT                   /protein_id="BAG17282.1"
FT                   /translation="MTATEIRPAPKPGGTSDAARPVRWWSGRVSFRLHRRTALVSGCAL
FT                   LLAALLLLVSLGVGSYPVPVPDVARALFYGTGDRLAVHFVNRERLPQALLAILVGGALG
FT                   MSGAIFQSVSRNALASPDVIGFNSGAATGAILVIVAFGGAAAPVAAGAIVGGLVTALLV
FT                   SVLASRGGLHGIRLVLIGLGVTAMLGSVNSYLLTRSSLNDAQNAHIWLVGTLNGRGWSS
FT                   VQIMAVALALLLPPVLLFGRRLRMMELGDDLATGLGVRVNSSRLALTVLGIGLCGVAVA
FT                   SAGPIPFIALAAPQIAAMVSRSPGVSLVSAGAVGAGLLSAAHLASSQFFSALVWADRQV
FT                   GWVHVVEESQRNNLLPVGVTTAVLGGAYLGWVLFKRRGTGTA"
     gtgacggcga cggagatccg ccccgccccg aagcccggcg ggacgtcgga cgccgcccgc        60
     ccggtgcgct ggtggtccgg acgggtcagc ttccgcctgc accggcgcac ggccctggtg       120
     agcggctgcg ccctgctgct cgcggcgctc ctgctgctgg tcagcctggg cgtcggctcc       180
     taccccgtgc cggtgcccga cgtggcgcgc gccctgttct acgggacggg cgaccggctg       240
     gccgtccact tcgtcaaccg ggagcgcctg ccccaggccc tgctggcgat cctggtcggg       300
     ggtgcgctcg gaatgagcgg cgcgatcttc cagagcgtgt cgcgcaacgc gctcgccagc       360
     cctgacgtca tcgggttcaa cagcggggcg gcgaccggcg ccatcctggt catcgtggcg       420
     ttcgggggcg ccgccgcccc ggtggccgcc ggagcgatcg tcggcggcct ggtcaccgca       480
     ctgctggtct cggtcctggc gagcagggga gggctgcacg gcatccggct ggtcctcatc       540
     gggctcggcg tgacggcgat gctcggctcg gtcaactcct acctgctgac gcggtcctcc       600
     ctcaacgacg cccagaacgc gcacatctgg ctcgtcggga cgctcaacgg gcggggctgg       660
     agctccgtgc agatcatggc cgtcgccctg gcactcctcc tgccgccggt gctgctgttc       720
     ggcaggcgcc tgcggatgat ggagctcggc gacgatctcg ccaccggtct gggcgtccgg       780
     gtgaacagct cgcggctcgc cctgacggtg ctggggatcg ggctgtgcgg cgtggccgtc       840
     gcgagcgccg ggcccatccc gttcatcgcc ctggccgccc cgcagatcgc cgccatggtc       900
     agtcgcagcc cgggtgtcag cctggtctcg gcgggggcgg tgggcgccgg actcctctcg       960
     gccgcacacc ttgcttccag ccagttcttc tccgccctgg tgtgggccga ccggcaggtc      1020
     ggatgggtcc acgtcgtgga ggagtcccag cgcaacaacc tgctgccggt gggcgtcacc      1080
     accgccgtgc tgggcggtgc gtacctgggc tgggtgctgt tcaagcggcg cggaaccggc      1140
     accgcgtga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page