(data stored in ACNUC7421 zone)

EMBL: AP009493.PE454

AP009493.PE454       Location/Qualifiers
FT   CDS_pept        complement(535804..536871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_454"
FT                   /product="putative FecCD-family membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17283"
FT                   /db_xref="GOA:B1VQI2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI2"
FT                   /protein_id="BAG17283.1"
FT                   /translation="MTAPPAALGRRSAARKPPPEPTAVRSALRGGGLLVLTGLLLLLVV
FT                   LSTWIGTKDTTLGQVWTALWNDDGSYATDVIRQLRLPRTLVGLMTGAALGVAGAVMQAV
FT                   TRNPLADPGLLGVNAGASAAVVFGIGVVGLAGFGSLVWFSFVGAALTTVIVYVLGASGR
FT                   AGPTPVRLALAGAAVSASLSGVIAGLTVFDSATYDYLRFWMVGSLAGREPELVVQLLPF
FT                   VAIGLVIALLLARPLNSLALGEELGRALGARIARTRIAAVIAVTLLCGASTAAAGPIGF
FT                   VGLVVPLVARWLTGPDLRWVLPYSMLLAPVLLLVSDIIGRVALPGDELEVGAVTAVIGA
FT                   PVFIAMVCRRKEASL"
     gtgaccgccc cgcccgccgc tctcggccgc cggtccgccg cccgcaagcc gccgccggaa        60
     cccaccgccg tccggtccgc cctgcgcggc ggcggcctcc tcgtcctcac cgggctgctc       120
     ctgctcctcg tcgtgctgag cacctggatc ggcaccaagg acaccacgct cggccaggtg       180
     tggaccgcgc tctggaacga cgacggctcg tacgccaccg acgtgatccg ccaactccgc       240
     ctgccgcgca cgctcgtcgg tctgatgacc ggtgcggcgc tcggcgtggc gggggcggtg       300
     atgcaggccg tcacccgcaa ccccctggcc gacccggggc tcctcggcgt caacgcgggg       360
     gcctcggcgg cggtcgtgtt cggcatcggc gtcgtcggcc tggccggttt cggttcgctg       420
     gtgtggttct ccttcgtcgg cgcggcgctc accaccgtga tcgtgtacgt gctcggcgcc       480
     tcaggacggg cggggcccac gcccgtgcgc ctcgcgctgg ccggtgccgc ggtgagcgcc       540
     agcctgagcg gcgtcatcgc cggactcacc gtcttcgact ccgcgaccta cgactacctg       600
     cggttctgga tggtcggatc gcttgccggg cgcgaacccg aactcgtcgt gcagttgctg       660
     ccgttcgtgg ccatcggcct ggtcatcgcc ctgctgctgg cccggccgct gaactccctg       720
     gctctgggag aggagttggg gagggcgctc ggggcgcgca tcgcccggac ccggatcgcc       780
     gcggtgatcg ccgtcaccct gctctgcggc gcctcgacgg ccgccgccgg gcccatcggc       840
     ttcgtgggcc tggtcgttcc gctggtcgca cgctggctca ccgggccgga cctgcgctgg       900
     gtgctgccgt actcgatgct gctggccccg gtgctgctgc tggtctccga catcatcggc       960
     cgagtggccc tccccggtga cgagttggag gtcggcgccg tgacagcggt gatcggcgcg      1020
     ccggtgttca tcgcgatggt ctgccggcgc aaggaggctt cgctgtga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page