(data stored in ACNUC7421 zone)

EMBL: AP009493.PE455

AP009493.PE455       Location/Qualifiers
FT   CDS_pept        complement(537172..538065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_455"
FT                   /product="putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17284"
FT                   /db_xref="GOA:B1VQI3"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI3"
FT                   /protein_id="BAG17284.1"
FT                   /translation="MTIHRAVVARVQPLTESMTRVTLHGDGLAGFRTTGVGDEYVRIFL
FT                   PHGPDRTDVSLPRTTEQGGWETPEGQPVAPMRTYTIRAARPEAGEVDIDFVLHEGGVAS
FT                   GWAAEARPGDVVGVNDPTGLYSPPADLSWQVLVADQTGLPAAARLLENTPDHVRTRVVL
FT                   EAPAPSAVLPLREPSDSKVTWTYGGNGHGPSRLADLVAAAVPPGTDLAGGYVWVAGETN
FT                   ALRSVRRYLRRDLGLPADRFKVVGYWIPNSDTWSERYEALPDAVRAELEALWDNPAGDS
FT                   EDLTIRYEARLSDLGL"
     atgacgatcc accgagccgt cgtcgcccgg gtgcaaccgc tcaccgagtc catgacccgc        60
     gtcaccctgc acggtgacgg tctggccggc ttccggacca ccggggtcgg cgacgagtac       120
     gtgcggatct tccttccgca cggcccggac cgcaccgacg tgtccctgcc ccggacgacc       180
     gagcagggcg ggtgggagac ccccgagggg cagcccgtcg cgccgatgcg cacgtacacg       240
     atccgcgccg cgcgccccga ggccggcgag gtcgacatcg acttcgtgct gcacgagggc       300
     ggcgtggcgt ccggctgggc cgccgaggcg cggcccgggg acgtcgtggg cgtcaacgac       360
     cccaccggcc tctacagccc cccggccgac ctctcctggc aggtgctggt cgccgaccag       420
     accggtctgc ccgccgccgc ccgtctgctg gagaacacgc cggaccatgt ccggacccgg       480
     gtggtgctgg aggcgcccgc gccctcggcc gtactgcccc tgcgggagcc ctcggactcc       540
     aaggtgacct ggacctacgg cggcaacggc cacggcccga gccgcctggc cgacctggtg       600
     gccgccgccg ttccgccggg cacggacctc gcgggcgggt acgtctgggt cgcgggggag       660
     accaacgccc tccgctcggt gcgacgttac ctccgccgtg acctcgggct ccccgcggac       720
     cgcttcaagg tcgtcggcta ctggataccg aactccgaca cctggtccga gcggtacgag       780
     gcgctgcccg acgccgtgcg cgccgagttg gaggccctct gggacaaccc ggccggtgac       840
     tccgaggacc tcaccatccg ctacgaggcc cggctgagcg acctcgggct ctga             894
//

If you have problems or comments...

PBIL Back to PBIL home page