(data stored in ACNUC7421 zone)

EMBL: AP009493.PE456

AP009493.PE456       Location/Qualifiers
FT   CDS_pept        538217..539245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17285"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI4"
FT                   /protein_id="BAG17285.1"
FT                   /translation="MPVRYPRPLRPGDRVGVTSPSSGVPAELRERLAVAVRDVEARGYE
FT                   VVTGRCMDGAGHVSAPAADRAAELTAMLTDPGIRAVVPPWGGETAIDLLPLLDWERLRT
FT                   AEPTWVVGYSDMSTVMTPLTLLTGAATVHGNNLMDTPYRVPEGLVSWLDVVAAPSGHRF
FT                   TQIPPGRHRATGYDDYAAHPGVRTFTLDTPGRWTRLDGDGDVDVEGRLIGGCVEMLSNL
FT                   TGTPYLDVPAFAGAHAPEGLLVYVEAGGHDAFTICRNLHGMRLAGFFDAANAVLVARTS
FT                   APDSGSFTQRQAVLDALGPLNVPIVADVECGHVQPYLPLVNGARGRVVHTATRGELTQT
FT                   LD"
     atgcccgttc gctatccacg ccccctgcgg cccggtgacc gggtcggggt cacctccccg        60
     tccagcggag tgcccgcgga actgcgcgag cggctcgccg tcgcggtccg cgacgtggag       120
     gcacgggggt acgaggtcgt gaccggccgg tgcatggacg gcgccgggca cgtcagcgcg       180
     cccgcggccg accgggcggc cgagttgacg gcgatgctga cggaccccgg catccgggcc       240
     gtggtgccgc cctggggcgg tgagacggcc atcgacctgc tgcccctgct cgactgggag       300
     cggctgcgca cggccgagcc cacctgggtg gtgggctact cggacatgtc gaccgtcatg       360
     acaccgctga ccctcctcac gggggccgcg accgtgcacg ggaacaacct catggacacg       420
     ccctaccggg tgccggaggg gctggtgtcc tggctcgacg tcgtcgcggc gccgtcgggg       480
     caccggttca cccagattcc gccggggcgg caccgggcca cgggctacga cgactacgcc       540
     gcgcaccccg gcgtccgcac gttcacactc gacaccccgg gccggtggac gaggctggac       600
     ggcgacggcg acgtggacgt cgaaggccgg ttgatcgggg gctgcgtcga gatgctgagc       660
     aacctcaccg ggacgccgta cctcgacgtc cccgccttcg ccggggccca tgccccggag       720
     ggcctcctgg tgtacgtgga ggccggcggc cacgacgcgt tcaccatctg ccgcaatctg       780
     cacgggatgc ggctggccgg cttcttcgac gcggccaacg ccgttctcgt cgcccggacc       840
     tcggccccgg acagtggctc gttcacccag cgccaggcgg tgctggacgc cctcgggccg       900
     ctgaacgtcc cgatcgtcgc ggacgtcgag tgcggccacg tccagccgta cctccccctg       960
     gtcaacgggg cgcggggccg ggtcgtccac acggcgacgc gcggcgagct gacgcagacg      1020
     ctggactga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page