(data stored in ACNUC7421 zone)

EMBL: AP009493.PE458

AP009493.PE458       Location/Qualifiers
FT   CDS_pept        complement(540264..540827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17287"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1VQI6"
FT                   /protein_id="BAG17287.1"
FT                   /translation="MSTTALDDRRILAIVTNYGVEQDELVVPVKHLRAHGARVSVAAVS
FT                   ADGIRTLVGDRDPGETVRPDLTLDDVDPAAYDLLLVPGGTLNADSLRLEDATTRIVSSF
FT                   AASGRPVAAICHGPWALVEGGYVRGKTLTSYASLRTDITNAGGTWVDKPVVRDDAAGWP
FT                   LITSRNPGDLDDFLGEIDAVLDES"
     atgtccacca ccgctctcga cgaccgccgg attctggcca tcgtcaccaa ctacggggtc        60
     gagcaggacg aactcgtcgt ccccgtgaag cacctgcggg cacacggggc gcgggtcagc       120
     gtcgcggcgg tctccgccga cgggatccgc accctcgtcg gcgaccggga tcccggcgag       180
     accgtgcggc ccgacctcac gctcgacgac gtcgaccccg ccgcgtacga cctgctgctg       240
     gtcccgggcg gcacgctgaa cgccgactcg ctgcggctgg aggacgccac cacccggatc       300
     gtcagctcgt tcgcggcttc cggccggccg gtggccgcga tctgccacgg gccgtgggcg       360
     ctggtcgagg gcggctacgt ccggggcaag acactgacct cgtacgcgtc gctgcggacc       420
     gacatcacca acgcgggcgg cacctgggtc gacaagccgg tggtccggga cgacgccgcc       480
     ggctggccgc tgatcacctc caggaacccc ggcgacctgg acgacttcct cggcgagatc       540
     gacgccgtgc tggacgagtc ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page